KEGG   Drosophila yakuba: Dyak_GE16016Help
Entry
Dyak_GE16016      CDS       T01068                                 

Definition
GE16016 gene product from transcript GE16016-RA
Orthology
K04646  
clathrin heavy chain
Organism
dya  Drosophila yakuba
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dya00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dyak_GE16016
   04142 Lysosome
    Dyak_GE16016
Exosome [BR:dya04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dyak_GE16016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1678 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIEANKEPTTLFCFAVRTATGGKLHIIEVGAPPNGN
QPFAKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYVFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTNKALIDLFEGFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERYLKENQY
YDSRVVGRYCEKRDPHLACVAYERGLCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLENYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGNRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESCKQDIAEELLGWFLE
RDAYDCFAACLYQCYDLLRPDVILELAWKHKIVDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDSTEHKNIIQMEPQLMITAGPAMGIPPQYAQNYPPGAATVTAAAGRNMGYPYL
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccactgcccatccgctttcaggagcatttacagctcacaaatgtcgggatc
aacgccaattcattttcattcagcacgctcacgatggaatcggataagtttatttgcgtg
cgggagaaggtgaatgataccgcccaagtggtcatcattgacatgaacgatgccaccaat
cccacgcggcgtcccatctcagcggattcggctatcatgaatcccgctagcaaggtcatt
gcgctcaaagcgcaaaagacgctgcagatcttcaacattgagatgaagtcaaagatgaag
gcgcataccatgaacgaggatgtggtgttctggaagtggatctccctcaatacgctagct
ctggtcacagaaacgagtgtgttccattggtccatggagggcgattcgatgccgcagaag
atgtttgaccggcattcatcgctgaacggatgtcaaatcatcaactaccgctgcaatgcc
tcccagcagtggctactcctggtcggcatttcggctctgccgagtcgcgttgccggtgcc
atgcagttgtattcggtggagcgcaaggtctcccaggctatcgaggggcacgcggccagt
tttgccacgttcaaaatcgaagctaacaaggaaccgacaacgctgttctgctttgcagtg
cgcacggccactgggggcaagcttcatatcatcgaagttggtgctccgccgaacggcaat
cagccgtttgccaagaaggctgtcgatgtcttctttccgccggaagcacaaaatgatttc
cctgtggcaatgcaagtctctgccaagtacgacaccatctacttgataaccaagtatgga
tacatacatctgtatgatatggagacagccacgtgcatatacatgaatcgtatatcggcc
gatacgatctttgttaccgcaccgcatgaggcaagtggcggcatcattggcgtcaatcgc
aagggacaggtcctctccgttaccgtcgatgaggagcagatcattccctacatcaacacc
gtgctgcagaatcccgatttggcccttcgcatggctgtgcgcaacaatttggccggcgcc
gaagatctctttgtgcgaaagttcaacaaactatttacggccggccagtatgccgaggcg
gctaaagttgccgccctggcacccaaggccatactgcggacgccacagacgatccagcgt
ttccaacaggtgcagacaccagctggctccacgactccgccgctgctgcaatactttggc
attctgctggaccagggcaagctgaacaagttcgagtctctggagctgtgtcgaccagtc
ttgctgcagggcaagaagcagctgtgcgagaagtggctgaaggaggagaagcttgagtgc
agcgaggagttgggtgatctggtcaaggcctccgatcttacccttgccctgtccatctat
ctacgcgcaaatgtacccaacaaggtgatccaatgctttgctgagaccggacagttccag
aagattgttctctacgccaagaaagtcaactatacgcccgattacgtattcctgctgcgc
tccgtgatgcgaagcaatccggagcagggagctggtttcgcctccatgctggtggccgag
gaagagccactggcggacatcaatcagattgtggacatcttcatggagcactccatggtg
cagcagtgcactgcgttcctgctggacgccctcaagcataaccgacccgctgagggcgcc
ctccagacgcgcctgctggaaatgaatctgatgtccgctccgcaggtggccgacgccatc
ctgggcaacgctatgttcacccactacgatcgggcccacattgcccagctatgcgagaag
gcaggactgctccagcgcgcccttgagcactacacggatctgtatgacattaagcgggcc
gtggtgcacacgcacatgctgaatgccgaatggctggtcagtttctttggcactctgtcg
gtggaggactcgctggaatgtctgaaggcaatgcttacggcaaatttgcgtcagaacttg
cagatctgtgtgcagattgccaccaagtaccatgaacagctgaccaacaaggcactcatt
gacctgttcgaaggtttcaagagctacgacggactgttctacttcctgagcagcattgtc
aacttctcacaggatcccgaagtgcacttcaaatacattcaggcggcctgcaagactaat
cagatcaaggaggtggagcgcatttgccgcgaatcaaactgctacaatccggagcgggtg
aagaacttcctgaaggaggccaagctgacggatcagctacctttaattattgtttgtgat
cgtttcgatttcgtgcacgacttggtgctttacctgtatcgtaacaatctgcaaaagtac
atcgagatttatgtgcagaaggtgaacccatcccgcttgcctgttgtagtgggtggcctt
cttgatgttgactgcagtgaggacataatcaaaaatctaattctcgttgtcaagggacaa
ttctccaccgacgagctcgtcgaggaagtcgagaaacgcaaccgcctcaagctcctcctt
ccctggctggagtcccgagttcacgagggctgcgtcgagccagccacccataatgccttg
gccaagatctacattgactcgaacaacaaccccgagagatatcttaaggagaatcagtac
tacgatagccgtgtggtcggtcgctactgcgagaagcgggatccccatttggcgtgtgtt
gcctacgagcgtggattgtgcgatcgcgagctgattgccgtttgcaatgagaactcactg
ttcaagagcgaagcacgctatttggttggtcgtcgcgacgccgaactgtgggccgaggtc
ctttcggagagcaatccctacaagcgccagttgatcgatcaggtggtgcagacggctttg
tccgagacccaggatcccgatgacatctcggtgacggtcaaggcattcatgaccgccgat
ttgcccaatgagctgattgaacttctggagaagattattctggactcgtccgtctttagc
gatcatcgcaatctgcagaacttgcttattctcacagccatcaaggccgatcgcacccga
gtcatggactacatcaacaggctggagaactacgatgctcccgatatcgcgaacattgcg
atcagtaatcagttgtacgaagaagccttcgccatcttcaagaagttcgatgtgaacaca
tcggccattcaggtgctcatcgatcaagtgaacaacctggagcgggccaacgagttcgcc
gagcggtgcaatgagccggccgtttggtcgcagctggccaaggcccaactgcagcagggt
ttggtcaaggaggctatcgattcgtacatcaaggctgatgatcctagcgcctacgtcgat
gtcgtcgatgtggccagcaaggtggagtcgtgggatgacctcgttcgctatctgcaaatg
gcgcgcaagaaggcacgcgaatcttacatcgagagcgaactgatctatgcgtatgctcgc
actggacgtctggccgatctggaggagttcatttcgggtcccaaccatgccgacatccag
aagattggcaaccgttgcttcagcgacggcatgtacgatgcagcgaagctcctgtacaac
aatgtaagcaactttgcacgcctggccattactttggtatacctgaaggagttccaaggg
gctgtggactcggcgcggaaagccaactcaacgcgcacatggaaggaggtgtgtttcgcc
tgcgtggacgccgaggagtttaggctagcccagatgtgtggcctgcacattgtggtgcat
gccgatgagctggaggatctgattaattactatcagaaccggggatacttcgatgaattg
attgcgctactcgagtcggctttgggactggaacgtgcgcacatgggaatgttcaccgaa
ttagctatactttattctaaattcaaaccttccaaaatgcgagaacacttggagctgttc
tggtctcgcgttaacattccaaaagttctgcgtgccgctgaatcggctcacttgtggtcg
gagctggtattcctgtatgacaagtatgaggagtacgataacgctgtactggccatgatg
gcccatcccacggaggcgtggcgtgagggtcactttaaggacatcatcaccaaggtggcc
aacattgagctgtactacaaggccattgaattctatttggatttcaagccgctgttgttg
aacgacatgctcctcgtgctggcacccagaatggatcacactcgtgctgttagttacttc
tccaagaccggctatttgccactcgtcaagccttatctgcgttcagtccaatctctcaat
aacaaggcaatcaacgaagccctgaacggactccttatcgacgaggaggactaccagggt
ctgcgcaactcgatcgatggatttgacaactttgacaacattgcgttggcacagaaactc
gaaaagcacgaacttaccgaattccgtaggattgccgcctacttgtacaagggaaataac
cgctggaaacagagtgttgagctctgcaaaaaggacaaactctacaaggatgctatggag
tacgccgccgaatcttgcaagcaagatattgccgaggagctgttgggttggttcctagaa
cgtgacgcatacgattgttttgcagcttgtctttatcagtgctacgacttgctgcgccct
gatgtcattttggagttggcctggaaacataaaatcgttgactttgccatgccctattta
attcaggttctgcgggaatacacaacaaaggtggacaaactggagttaaacgaagctcag
cgcgagaaggaggacgattccactgagcacaaaaacattattcaaatggagccacaactg
atgatcaccgctggcccagcaatgggaatacctccacaatatgcacagaattatccaccc
ggtgcagcaacggtaacggcggcagcaggacgcaacatgggctatccctacttgtag

DBGET integrated database retrieval system