KEGG   Drosophila yakuba: Dyak_GE16053Help
Entry
Dyak_GE16053      CDS       T01068                                 

Gene name
dyak_GLEANR_17511
Definition
(RefSeq) GE16053 gene product from transcript GE16053-RA
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dya  Drosophila yakuba
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dyak_GE16053 (dyak_GLEANR_17511)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    Dyak_GE16053 (dyak_GLEANR_17511)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dyak_GE16053 (dyak_GLEANR_17511)
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dyak_GE16053 (dyak_GLEANR_17511)
Transcription machinery [BR:dya03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dyak_GE16053 (dyak_GLEANR_17511)
Messenger RNA biogenesis [BR:dya03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     Dyak_GE16053 (dyak_GLEANR_17511)
Spliceosome [BR:dya03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dyak_GE16053 (dyak_GLEANR_17511)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 302 aa AA seqDB search
MAEVLNLESIIARLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLR
GNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLD
LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtgctcaatctggagagcatcattgcccgcctgctggaggtgcgtggcgcc
aggcccggcaagaatgtgcagctgtcggagggcgagatccgtggactgtgcctcaagtcg
cgcgaaatactgctggctcagcccatactccttgagctggaggcgccgctcaagatctgc
ggcgatatccatggccagtactatgatctgttgcgtctattcgaatacggcggctatccg
ccggaggccaactatctattcttgggcgactacgtggacaggggcaagcagtcgctggag
accatctgcctgctgttggcctacaagatcaagtattcggagaacttctttctgctgcgc
ggcaatcacgagtgcgccagcattaatcgaatctatggattctacgatgagtgcaagcgc
agatataccattaagttgtggaagacatttaccgattgtttcaactgtctgccggtggtg
gccattgtggatgagaagatcttttgctgccacggcggactgagtccggatctcacttcg
atggagcagatccgtcggattatgcgacccaccgatgtgcccgatcagggactgctatgc
gatctgctttggtccgatccggacaaggataccattggttggggcgagaacgaccgtggc
gtcagcttcacctttggcgccgaggtggtcgtcaagtttctacagaagcacgatctcgat
ctgatctgtcgtgcccaccaggtcgtcgaggatggttacgagttctttgccaagcgccaa
ttggtcaccctcttctccgcccccaactattgcggtgaattcgacaatgccggtgccatg
atgtccgtggacaataccctcatgtgctccttccaaatcctcaagcccgtcgagaagcgc
aagaagtag

DBGET integrated database retrieval system