KEGG   Drosophila yakuba: Dyak_GE16180Help
Entry
Dyak_GE16180      CDS       T01068                                 

Definition
GE16180 gene product from transcript GE16180-RA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dya  Drosophila yakuba
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE16180
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dyak_GE16180
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dyak_GE16180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 492 aa AA seqDB search
MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGARGPGVSGSVPSARVPPLVTSASAAT
SAAHAPTLGTGSVSGSGISIAQRPAPPVPHATPFASASTSSSSSASAFASAAPATGAFGG
TYTPPTTRVPRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHQPVSETDKKLKIIMEQTG
KLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMLHLSSNTIIAVKQMRRTGNAEENKRIL
MDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTV
ATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYM
APERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGE
GYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRTYEIAKVDVPNWFQSIKDNRLRAA
NGDPTLQRLPNS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccattgagttcgagacgatcggcagtcggctgcaatccttggaggcgaagctc
caggcgcagaatgagtcccacgaccagatcgtcctttccggtgcgcgcggaccaggcgtt
tccggttccgttccgtctgcccgcgttccgcccctggtgacatccgcatcagcagccaca
tccgccgcccacgcaccgaccctgggcacaggttccgtttccggatcgggaatcagcata
gcccagcggccggcacctccagttcctcatgcgacgccctttgccagcgccagcacctcg
tcatcctcatccgcatccgcatttgcatccgcagcaccggcgacgggcgccttcggtgga
acatacaccccgcccacaaccagagtgccgcgagccacgcccacactgcccatgctttct
agcggacccggtggcggactgaatcggacgcggccagtgatacttccgctgcccacgccg
ccgcatcaaccggtttcggaaacggacaagaagctgaagatcatcatggagcagaccggc
aagctgaacatcaacgggcggcagtatccgacggacatcaatgacctcaagcacctgggc
gacctgggcaacgggaccagtggcaatgtggtgaagatgctgcacctgtccagcaacacg
atcatcgccgtaaagcagatgcgtcgcactggcaacgcggaggagaacaagcgcatcctg
atggatctggatgtggtgctcaagtcgcatgactgcaagtatattgtcaagtgccttggc
tgtttcgttcgcgatccggatgtgtggatctgcatggagctgatgtccatgtgctttgac
aagctgctcaagctctccaagaaaccggtgccggaacaaattctgggcaaggtcacagtg
gcgacggtcaacgcattgtcctatctgaaggacaagcacggggtcatccatcgagatgtg
aagccctcgaacattctgatcgacgagcgcgggaacatcaagctctgtgatttcgggatc
agcggtcgcctggtggactccaaggccaacactcgatccgccggctgtgcagcctacatg
gcgccggaacgcatcgaccccaagaaaccaaagtacgacattcgcgctgatgtgtggtca
ctgggcataacgctggtggagctggccaccgcgcgatccccgtacgagggatgcaacacg
gacttcgaggtgctcaccaaggtgctggactcggagccgccgtgtttgccatacggcgag
ggctacaactttagtcagcagttccgcgatttcgtcatcaagtgcctcacaaagaaccat
caggatcgacccaagtatccggagcttctggcccagcccttcatccggacttatgaaata
gccaaagtagatgtgcccaattggtttcagagcatcaaggataaccggctgcgtgccgcc
aatggcgatccaacgctccagaggttacctaattcctaa

DBGET integrated database retrieval system