KEGG   Drosophila yakuba: Dyak_GE16341Help
Entry
Dyak_GE16341      CDS       T01068                                 

Definition
GE16341 gene product from transcript GE16341-RA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dya  Drosophila yakuba
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dya00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dya04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dya04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:dya04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1095 aa AA seqDB search
MTKKYEFDWIIPVPPELTTGCVFDRWFENEKETKENDFERDALFKVDEYGFFLYWKSEGR
DGDVIELCQVSDIRAGGTPKDPKILDKVTKKNGTNIPELDKRSLTICSNTDYINITYHHV
ICPDAATAKIWLDGIRKITHNVKANNICPMMCLRKHWMRLSYCVEKSGKIPVKTLAKTFA
SGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFYALYHKVCPRNDIEELFTSITKGKQ
DFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTEIINDYELDEEKKKNVQMSLDGFKR
YLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNTYLSGRQIGGKSSVEMYRQTLLAGC
RCVELDCWNGKGEDEEPIVTHGHAYCTEILFKDCIQAIADCAFVSSEYPVILSFENHCNR
AQQYKLAKYCDDFFGDLLLKEPLPDHPLDPGLPLPPPCKLKKKILIKNKRMKPEVEKVEL
ELWLKGELKTDDDPEEDASAGKPPEAAAAPAPAPEAAAATEGAAEGGGGAEAEAAAANYS
GSTTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYN
KRQMSRIYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLL
KPDFMRRADKDFDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVK
KEFRTRLVANNGLNPVYNEDPFVFRKVVLPDLAVLRFGVYEESGKILGQRILPLDGLQAG
YRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKAL
GIEEQSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKH
AKERTSVQKTQNAAIDKLIKGKSKDDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLR
QHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTK
NEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQVEEFSTDVQKLMDMYKI
EEEAYKTQGKTEFYA
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaagtacgagttcgattggatcattccggttccgccggaattgaccacgggc
tgtgttttcgatcgctggttcgagaacgagaaggagacgaaggagaatgactttgagcgc
gatgccctcttcaaggtcgacgaatacggatttttcctgtattggaaaagcgagggccgg
gatggcgatgtcattgagctctgccaagtgagcgacattcgtgcgggaggaacacccaag
gatccgaagatactcgataaggtgaccaagaagaacggcaccaatataccggaactggat
aagcgttccctgacgatctgttcgaacacggactatatcaatataacatatcaccatgtt
atttgtccagatgcggcaacagccaagatctggctagatggcatacgaaaaataacccat
aatgtcaaagcgaacaatatctgccccatgatgtgtctgcggaaacattggatgcgattg
agttactgtgtagagaagagtggcaaaattccggttaaaacgctggccaaaaccttcgca
tccggcaaaacggagaaattggtgtacacgtgcataaaggatgccggtctgcccgatgac
aaaaacgcaacgatgaccaaggagcagttcaccttcgacaagttctacgccttgtaccac
aaggtgtgtccccgaaacgacattgaggagctcttcacctccatcaccaagggcaagcag
gactttatcagcttggagcaatttatccagttcatgaacgacaaacagcgtgatccgcgg
atgaacgagatcctgtatcctctctacgaggagaaacgctgcacggagatcatcaacgat
tacgagttggatgaggaaaaaaagaaaaacgttcaaatgtcgctggatggatttaagcgc
tacttgatgtccgacgagaacgcacctgtattcctggaccgtctggatttctacatggaa
atggatcagccactggcccattactatatcaacagctcgcataatacctacctatccggc
cgtcagatcggcggcaaaagttccgtggaaatgtaccgccagacactcttggcaggctgt
cgatgtgtggagttggattgctggaacggaaagggtgaggacgaggagccaatcgtcacc
cacggccacgcctactgcaccgaaattctctttaaggactgcatccaggcgattgcggac
tgcgccttcgtgtcctccgagtacccggtaattctgtccttcgaaaaccactgcaaccgc
gcccagcaatacaagttggccaaatactgtgatgacttctttggcgacctgctgctgaag
gagccgctaccagatcacccgctggacccgggtcttccgctaccgccaccctgtaagctg
aagaaaaagatcctcatcaagaacaagcgaatgaagccggaggtggaaaaggtcgagctg
gagctctggctgaagggcgaacttaagacggacgacgatccggaggaggacgccagtgca
ggcaagcccccggaggcagctgccgcccccgctcccgccccggaagcagccgccgccacc
gaaggagccgccgagggaggcggtggtgcggaggccgaagccgccgctgccaactacagc
ggctccaccaccaacgtgcatccgtggctctcctccatggtcaattacgcgcagcccatc
aagttccagggcttcgacaaggcaatcgaaaagaacattgcccataacatgtcctcgttt
gcggaatcggcgggcatgaactacttgaagcagagctctatcgactttgtcaattacaac
aagcgtcagatgtcgcgaatttacccgaagggcacgagagcggactcctcaaactatatg
ccgcaggtgttttggaacgccggctgccagatggtctcactcaacttccagagctccgac
ctacccatgcaactcaaccagggcaagttcgagtataacggcggctgtggctatctactg
aagccggatttcatgcgtcgagccgacaaggattttgatccatttgccgatgcgccggtg
gatggcgtgattgccgcccagtgctccgtgaaggtaatagccggccagttcttgtccgac
aagaaagtgggcacctatgtggaggtggacatgtttggattgccctcggacacggtgaag
aaggagtttcgcacgcgtttggtggccaataatggcttgaatccagtttacaatgaggac
ccctttgtgttccgcaaagtggtacttccggacttggctgtgctgagatttggcgtttat
gaggaaagcggaaagatcctgggtcaacgtatcctgccgctagacggtctacaggctggc
tatcgtcatgtttccctgcgcacggaggctaacttccccatgtcgttgcccatgttgttc
gtgaatattgagctaaagatctacgtacctgacggctttgaggacttcatggccatgttg
tcggatccgcgaggattcgccggtgccgctaagcagcaaaatgaacagatgaaggccctc
ggcattgaggagcagagcggcggtgccgcccgagatgctggcaaggccaaagaggaggaa
aagaaggagccaccacttgtctttgagcccgtcacgttggagtctctgcgccaggaaaag
ggcttccaaaaggtgggcaaaaagcagatcaaggagctcgacaccctgcgcaaaaagcac
gccaaagagcgcacctcggtgcaaaagacccagaatgcggccatcgataagttaatcaag
ggcaagagcaaagacgacattcgcaacgatgccaacatcaagaactcgatcaatgatcag
acgaaacagtggaccgacatgatcgccaggcaccgcaaggaggaatgggacatgctgcgc
cagcatgtccaagattcgcaggatgcaatgaaggcgctgatgctcactgttcaggcggcg
cagatcaagcagctggaggatcgtcatgccagggatatcaaggatctgaatgccaagcaa
gcgaagatgtcggcggataccgccaaggaggtccagaacgacaagaccttgaagaccaag
aacgagaaggatcgtcggctgcgcgagaagcgtcagaacaatgtaaagcgcttcatggag
gagaagaagcaaatcggcgttaagcagggccgtgcgatggagaaactaaagttggcgcat
tcgaagcaggtcgaggaattcagtaccgacgtgcaaaagcttatggacatgtacaaaatc
gaggaggaggcctataagacgcaaggaaagacggaattttatgcctaa

DBGET integrated database retrieval system