KEGG   Drosophila yakuba: Dyak_GE16397Help
Entry
Dyak_GE16397      CDS       T01068                                 

Definition
GE16397 gene product from transcript GE16397-RA
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dya  Drosophila yakuba
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dya04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagacctccctgcccatggacatgtgctccaattttgatgcggacgagata
cgccgactgggcaagcgattccgcaaactggatctggacaattcgggcgccctgagcata
gacgagtttatgtcgctgccggaactgcagcagaatccgctggtgcagcgcgtcatcgat
atcttcgatgcggacggcaacggggaggtggacttcaaggagttcatccagggcgtgtcg
cagtttagcgtgcgcggcgataagctgtccaagctgcgattcgcgttccgcatctacgat
atggacaatgatggttacatctcgaacggagaactgttccaggtgctcaagatgatggtg
ggcaacaatctgaaggatacacagctgcagcagatcgtggataagaccatttgctttgcg
gacaaggacgaggatggcaagatatcgtttgatgagttctgctcggtggtgggcaacacc
gatatccacaagaaaatggttgtcgatgtttag

DBGET integrated database retrieval system