KEGG   Drosophila yakuba: Dyak_GE16403Help
Entry
Dyak_GE16403      CDS       T01068                                 

Gene name
dyak_GLEANR_17828
Definition
(RefSeq) GE16403 gene product from transcript GE16403-RB
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE16403 (dyak_GLEANR_17828)
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE16403 (dyak_GLEANR_17828)
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dyak_GE16403 (dyak_GLEANR_17828)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1129 aa AA seqDB search
MVKKRQADSHDHESSTDSGDEELHHRNALGSAGQVDGATPTTASCQHIKKAVDAARLRRL
LKSTGLLYECSQCQKLGKTVGSGAGSESGEGAGGSGGDPADFEFDSTLWLCLKCGSQLCG
RARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDMKICSNLRKNLLECVELVKKLAQK
PPTATVTPSPPTISYIEQKIKSTLEHLTPIVPMTGGSFDDSGGGGALAMGAGGGSRSSQV
AIPMPPPPPSSGQSPSDSLTSVPGMAKRIGQYSATTNGDTGDRRVLTLETPRIEMDRLPR
VRGLTNLGNTCFFNAVMQCLAQTPFLLSVLRELAEPGEEFVLPGGTFNIKDKGDIELPMI
KGTLSSWGGLTAALANALEELQAGGCVFTPSKLFDRLCMKCPQFTGGDQHDAHELLRQLL
ESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQVFRGFLV
STLTCQDCHSVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPELSPAPGSSSVTQTSSQPTI
NTKFTDGSVNFTASSTSFFLHAGEEGSLGPSKSQVKKEKERERKAKRAAKHQRHKQAQKL
SHKLNGNDSGNGNELAESGEPNAAPLASLGAGDGQANDGPEQPKVQTEDSTSSSVTTSEH
SDADVEDNLVEDTAPPSATNVSSSSASLTAPSKFYTDSNGNAQQLGEKRDDTPEHMDKDS
LEEDENDSGIATSPAPTATNSSTSTNATGNNNSGSGSGVLEDASAPASLVSAGLSEKGAS
LIRQISVEAEQGASNGTAGEAREAKAIAQPAKTANQAQAQAQVQAQSQAQALAQAQARAK
RVRTQSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDP
KAKSVNTNATKQLLVSSPPAVLILHLKRFQLGPRCVFRKLTRPVSYPNLLDIAAFCGSKV
KNLPNIDRKQKKLLYALYGVVEHSGGMYGGHYTAYVKVRPKVTPDDKRWKFLPHGSKAEL
DQDDDQLKKLEELLAKEKARELHLKAMDDSDDFSNSSSNSSTSDESHAPATPLEEQLPQQ
SQQQQQEEAANVHAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERIY
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaagcgtcaggcggacagtcacgaccacgagagctcaacggattccggcgat
gaggagctgcaccatcggaacgcactcggctccgccggacaggtggatggcgccacgccc
accaccgccagctgtcagcacatcaaaaaggcggtggatgctgcccgtctaaggcgtcta
ctgaagtccacggggctgctctacgagtgcagtcagtgccagaagctgggcaagacagtg
ggcagcggagcgggatcggaatcgggagaaggagctggcggttcaggcggagatcccgca
gacttcgagttcgacagcaccctgtggctgtgcctcaagtgcggcagccagctgtgcggg
agggcacgccacaagcacgccttagaacattaccagacacctcattcggactcgcatgcc
ctcgccatgaatacgcgctccttcgacatttggtgttatgagtgcgacatgaagatctgc
tccaatctgcgcaagaacctgctggagtgcgtggagctggtcaagaagttggcccagaag
ccgcccactgccacggtcacgcccagtccgcccacgattagctacatcgagcagaagatt
aaatccacgctggagcacctcacaccgatcgtgccaatgactggcggatcatttgacgac
tccggcggaggaggggctctggcgatgggcgccggcggaggatctcgaagcagccaggtg
gccataccgatgccaccaccaccgcctagttccgggcaatcgccctcagactcgctgacg
agtgtgccgggcatggcaaagagaattggtcagtactcggccaccaccaatggcgacact
ggggacaggcgagtcttgaccctggaaacgccgcgtatcgaaatggaccggctgccgcgc
gtgcgaggattgaccaacctgggcaatacttgcttctttaatgcggtgatgcagtgcctc
gcccagacgccgttcctacttagcgtgctaagagaactggcggagcccggggaagaattt
gtcttacctggaggaaccttcaacataaaggacaaaggagacattgagctgcccatgatc
aagggtaccctctcctcttggggcggactcaccgccgcgttagctaatgcccttgaggaa
ctgcaggcgggcggttgtgtatttacgcccagcaaactcttcgacaggttgtgcatgaaa
tgtccacagtttacgggcggcgatcagcatgatgctcacgaactgctgcgccagctgctg
gagagcgtgcggaacgaggatctaaagcgctaccagcgtgtgattctgcagaaccttggc
tacaaggatcaagatgtcaatagtgtgtcagaggagatgcgacagaagtgcaagatctat
ggcaaccaagcaggagaccgcatcctgcgcccggagcaggtattccgtggcttcctcgtg
tcaacgctcacctgccaggactgtcacagcgtttcctcgcggcacgagtactttctggac
atgtcgctgcccgtggccgtagagaagccacagccgccgcagcgccgaaagccaagtcct
gagctcagtccagcgcccggcagctccagcgtcacccagacctccagtcagccgacgata
aacaccaagtttacggatggaagcgtcaactttacagcctcatctacgtccttcttcctg
cacgctggcgaggagggatccctgggcccatccaaatcgcaggtgaagaaggagaaggag
cgcgagcgtaaagcaaagcgggcggccaagcaccagcgccacaagcaggcccagaagtta
agccataagctgaacgggaatgacagcggaaatggaaatgaattggccgagtccggagaa
ccaaacgctgctccactggcttccctcggtgccggcgatggccaagctaacgatggcccc
gaacagcccaaggtccagaccgaggactccacctcgtccagcgtgactacttcggagcac
tccgatgccgatgttgaggacaatctggttgaggacacagccccgccgtccgctaccaat
gtgtcgagcagttcggcatctttgacagctccctccaagttctacacggacagcaatgga
aatgcccagcagctgggcgagaagcgcgacgacacgccggagcacatggacaaggattcg
ctcgaagaggacgagaatgactcgggaatcgccaccagtccagcacccacagcaaccaac
agcagcaccagcacgaatgccacaggtaacaacaactctggttccggatctggcgtcctg
gaggatgcctccgcgccagcgagcctggtcagtgctggactttcagagaaaggcgcctcg
ctgatccgccagatctcagtggaagctgagcagggtgcatccaatggcacagctggcgaa
gctagagaagccaaggcgatagcgcagccagcgaagactgctaaccaggcccaggcacag
gcacaggtccaggcccagagccaggcccaagccttggcgcaagcccaggcccgtgcgaag
cgagtgcgcacgcagagctactcggactggagcaccacgatagcgccgcgttaccagtgc
gaggatggagagtgctcggtgcagtcctgcctgaacaatttcaccgctgtcgaactgatg
acggggcagaacaaggtgggatgcgacagctgcacgcagcgcattaacggcagcgatccg
aaggccaagtcggtaaacaccaatgcaacgaagcagctgttggtctccagtccgccagcg
gtgctcattctgcacctgaaacgcttccagctggggccgcgctgcgtcttccgcaagctg
acgcgcccggttagctatcccaatttgctggacattgccgccttctgtggctccaaggtg
aagaatttgcctaacattgatcgcaagcagaagaagctgttgtacgcgctgtacggcgtg
gtggagcactcgggtggcatgtatggtggccactacacggcgtatgtgaaggtgcggcca
aaggtgacgccggacgacaaacgctggaagttcctgccgcacggcagtaaagcggaactg
gaccaggacgatgatcagctgaagaaactggaggagctgcttgccaaggagaaggcgcgt
gaactgcacctgaaggcgatggacgacagcgatgacttcagcaactccagcagcaactcg
tccacctccgacgagagccatgccccagccacgccgctcgaggagcagctgccgcagcag
tcgcagcagcagcagcaggaggaggccgctaacgtgcatgcgccgcctggcaaatggtat
tacgtgtccgactcgcgtgttcaggaggtcagcgaggatacggctctgaaggcccaggcc
tatctgctcttctacgaacgcatatactag

DBGET integrated database retrieval system