KEGG   Drosophila yakuba: Dyak_GE16403Help
Entry
Dyak_GE16403      CDS       T01068                                 

Definition
GE16403 gene product from transcript GE16403-RA
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1157 aa AA seqDB search
MFRVLRFLTFGNRLERVHKEAKAKKVLAMVKKRQADSHDHESSTDSGDEELHHRNALGSA
GQVDGATPTTASCQHIKKAVDAARLRRLLKSTGLLYECSQCQKLGKTVGSGAGSESGEGA
GGSGGDPADFEFDSTLWLCLKCGSQLCGRARHKHALEHYQTPHSDSHALAMNTRSFDIWC
YECDMKICSNLRKNLLECVELVKKLAQKPPTATVTPSPPTISYIEQKIKSTLEHLTPIVP
MTGGSFDDSGGGGALAMGAGGGSRSSQVAIPMPPPPPSSGQSPSDSLTSVPGMAKRIGQY
SATTNGDTGDRRVLTLETPRIEMDRLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLSVLRE
LAEPGEEFVLPGGTFNIKDKGDIELPMIKGTLSSWGGLTAALANALEELQAGGCVFTPSK
LFDRLCMKCPQFTGGDQHDAHELLRQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSEE
MRQKCKIYGNQAGDRILRPEQVFRGFLVSTLTCQDCHSVSSRHEYFLDMSLPVAVEKPQP
PQRRKPSPELSPAPGSSSVTQTSSQPTINTKFTDGSVNFTASSTSFFLHAGEEGSLGPSK
SQVKKEKERERKAKRAAKHQRHKQAQKLSHKLNGNDSGNGNELAESGEPNAAPLASLGAG
DGQANDGPEQPKVQTEDSTSSSVTTSEHSDADVEDNLVEDTAPPSATNVSSSSASLTAPS
KFYTDSNGNAQQLGEKRDDTPEHMDKDSLEEDENDSGIATSPAPTATNSSTSTNATGNNN
SGSGSGVLEDASAPASLVSAGLSEKGASLIRQISVEAEQGASNGTAGEAREAKAIAQPAK
TANQAQAQAQVQAQSQAQALAQAQARAKRVRTQSYSDWSTTIAPRYQCEDGECSVQSCLN
NFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRFQLG
PRCVFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGGMYGGHY
TAYVKVRPKVTPDDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKARELHLKAMDDSDD
FSNSSSNSSTSDESHAPATPLEEQLPQQSQQQQQEEAANVHAPPGKWYYVSDSRVQEVSE
DTALKAQAYLLFYERIY
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgtgctgcgatttcttacctttgggaaccgcttggagcgcgtccacaaggag
gccaaggccaaaaaggtgctcgccatggtgaaaaagcgtcaggcggacagtcacgaccac
gagagctcaacggattccggcgatgaggagctgcaccatcggaacgcactcggctccgcc
ggacaggtggatggcgccacgcccaccaccgccagctgtcagcacatcaaaaaggcggtg
gatgctgcccgtctaaggcgtctactgaagtccacggggctgctctacgagtgcagtcag
tgccagaagctgggcaagacagtgggcagcggagcgggatcggaatcgggagaaggagct
ggcggttcaggcggagatcccgcagacttcgagttcgacagcaccctgtggctgtgcctc
aagtgcggcagccagctgtgcgggagggcacgccacaagcacgccttagaacattaccag
acacctcattcggactcgcatgccctcgccatgaatacgcgctccttcgacatttggtgt
tatgagtgcgacatgaagatctgctccaatctgcgcaagaacctgctggagtgcgtggag
ctggtcaagaagttggcccagaagccgcccactgccacggtcacgcccagtccgcccacg
attagctacatcgagcagaagattaaatccacgctggagcacctcacaccgatcgtgcca
atgactggcggatcatttgacgactccggcggaggaggggctctggcgatgggcgccggc
ggaggatctcgaagcagccaggtggccataccgatgccaccaccaccgcctagttccggg
caatcgccctcagactcgctgacgagtgtgccgggcatggcaaagagaattggtcagtac
tcggccaccaccaatggcgacactggggacaggcgagtcttgaccctggaaacgccgcgt
atcgaaatggaccggctgccgcgcgtgcgaggattgaccaacctgggcaatacttgcttc
tttaatgcggtgatgcagtgcctcgcccagacgccgttcctacttagcgtgctaagagaa
ctggcggagcccggggaagaatttgtcttacctggaggaaccttcaacataaaggacaaa
ggagacattgagctgcccatgatcaagggtaccctctcctcttggggcggactcaccgcc
gcgttagctaatgcccttgaggaactgcaggcgggcggttgtgtatttacgcccagcaaa
ctcttcgacaggttgtgcatgaaatgtccacagtttacgggcggcgatcagcatgatgct
cacgaactgctgcgccagctgctggagagcgtgcggaacgaggatctaaagcgctaccag
cgtgtgattctgcagaaccttggctacaaggatcaagatgtcaatagtgtgtcagaggag
atgcgacagaagtgcaagatctatggcaaccaagcaggagaccgcatcctgcgcccggag
caggtattccgtggcttcctcgtgtcaacgctcacctgccaggactgtcacagcgtttcc
tcgcggcacgagtactttctggacatgtcgctgcccgtggccgtagagaagccacagccg
ccgcagcgccgaaagccaagtcctgagctcagtccagcgcccggcagctccagcgtcacc
cagacctccagtcagccgacgataaacaccaagtttacggatggaagcgtcaactttaca
gcctcatctacgtccttcttcctgcacgctggcgaggagggatccctgggcccatccaaa
tcgcaggtgaagaaggagaaggagcgcgagcgtaaagcaaagcgggcggccaagcaccag
cgccacaagcaggcccagaagttaagccataagctgaacgggaatgacagcggaaatgga
aatgaattggccgagtccggagaaccaaacgctgctccactggcttccctcggtgccggc
gatggccaagctaacgatggccccgaacagcccaaggtccagaccgaggactccacctcg
tccagcgtgactacttcggagcactccgatgccgatgttgaggacaatctggttgaggac
acagccccgccgtccgctaccaatgtgtcgagcagttcggcatctttgacagctccctcc
aagttctacacggacagcaatggaaatgcccagcagctgggcgagaagcgcgacgacacg
ccggagcacatggacaaggattcgctcgaagaggacgagaatgactcgggaatcgccacc
agtccagcacccacagcaaccaacagcagcaccagcacgaatgccacaggtaacaacaac
tctggttccggatctggcgtcctggaggatgcctccgcgccagcgagcctggtcagtgct
ggactttcagagaaaggcgcctcgctgatccgccagatctcagtggaagctgagcagggt
gcatccaatggcacagctggcgaagctagagaagccaaggcgatagcgcagccagcgaag
actgctaaccaggcccaggcacaggcacaggtccaggcccagagccaggcccaagccttg
gcgcaagcccaggcccgtgcgaagcgagtgcgcacgcagagctactcggactggagcacc
acgatagcgccgcgttaccagtgcgaggatggagagtgctcggtgcagtcctgcctgaac
aatttcaccgctgtcgaactgatgacggggcagaacaaggtgggatgcgacagctgcacg
cagcgcattaacggcagcgatccgaaggccaagtcggtaaacaccaatgcaacgaagcag
ctgttggtctccagtccgccagcggtgctcattctgcacctgaaacgcttccagctgggg
ccgcgctgcgtcttccgcaagctgacgcgcccggttagctatcccaatttgctggacatt
gccgccttctgtggctccaaggtgaagaatttgcctaacattgatcgcaagcagaagaag
ctgttgtacgcgctgtacggcgtggtggagcactcgggtggcatgtatggtggccactac
acggcgtatgtgaaggtgcggccaaaggtgacgccggacgacaaacgctggaagttcctg
ccgcacggcagtaaagcggaactggaccaggacgatgatcagctgaagaaactggaggag
ctgcttgccaaggagaaggcgcgtgaactgcacctgaaggcgatggacgacagcgatgac
ttcagcaactccagcagcaactcgtccacctccgacgagagccatgccccagccacgccg
ctcgaggagcagctgccgcagcagtcgcagcagcagcagcaggaggaggccgctaacgtg
catgcgccgcctggcaaatggtattacgtgtccgactcgcgtgttcaggaggtcagcgag
gatacggctctgaaggcccaggcctatctgctcttctacgaacgcatatactag

DBGET integrated database retrieval system