KEGG   Drosophila yakuba: Dyak_GE16484Help
Entry
Dyak_GE16484      CDS       T01068                                 

Definition
GE16484 gene product from transcript GE16484-RA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dya  Drosophila yakuba
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dyak_GE16484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1143 aa AA seqDB search
MLSQFYCLCLSLLLYFFVGVTWAEEGDCRRLKRADIEGRLSTKTPYRAIANYDETPPKYA
GCHPTRIWSIIRHGTRNPSESVILQAQNRLSEIKNRILDQPNPPICTAELKKLRQWHWMH
LNATEDEKLLVAEGEDELIDLAERMQRRFPDILPELYNPEWYYFKYTATQRTLKSAESFA
TGLFGRHRIHTVRYPPPLHEDPVLRMVSYQNCIHLAACAANEILPMNAQLPADLFTSCLT
TPINIALKWYAMQEKLGMVPRIQSELIDKIPGKVNDRRTMMGELNWIFTAITDTIAWNTL
PLTLFQRLFRQDLLVASLFRNFLLAERILRSHDCTPVSLPALPPCYRHPMWKAWDLVVDL
ALQQLPEILDHNAPYRQLPFFEHQLTAFQVWLDSESESRTPPEQLPIVLQVLLSQVHRLR
ALELLARFLDLGPWAVNLALGVGIFPYVLKLLQSSTRELRPVLVFIWAKILAVDPSCQVD
LVKEYKYFLSVLQDTSVSKEHRTLSAFVLSSIVHNFLLGQTSALQGPLLSICLEQLNDGS
WLLRQWLAICLGMLWQNFEKARWSGARDLAHEKLYVLLRDKIPEVRAAAVFALGTFISSV
TDRSEEQANNIDRIIAITMLETVGEDMSPLVRMELAAALQWMVVLFESQFVAVYLAEHMR
GHVSAASFVMCPDPRELTSSTHSLERHVTIRRGASSSSISNMGGASTGSGTGSSSNPLGR
SKSGSASSGGRGAAGAAGGTNSIPFQSIFTKLWLGICNLAQDPFPRVAAIAQEIVDHVRD
TALCPIMAAKEATMSNASEKCSSLSVSLPPSPNTRVNYLGGGGAPGGAGATAESPPVGAA
ASGASHWAQKLRLSGSGACVAAGDPQTILQRKLRTTSINDETDSGPSYSRGFYKGCGKWK
TDVDKNPETLVNARRYLAEPQMRSAVEQIRSSTRLPDLQPEDVQLMYTVCAFETAWHRPR
RDSGSRSTYESVWCNFFDVAALEALEFFKDLEYYWNDGYGYELTHRIACPAIADMFASIG
SSEEKQQRRANATLYFTHSGTLLKLLAHLGLARDNKPLTHKHFASERLWRTSQIDAFATN
LAFLRYDCDEEKPQVLVLHQERVVRLPGCPQDKDLCPLATLRRIYAKSVDHCDREEMCRV
KAN
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atgctaagccaattttactgtttgtgtttgtcgctcctcctctacttcttcgtgggcgtg
acgtgggctgaggagggggactgccgccgccttaagcgcgcagatatcgagggcagactg
tccacaaagaccccgtacagagcgatcgccaattacgacgaaacgccgccgaaatacgcc
ggttgccatccgacgcgaatttggtccatcatccgacacggaacacgaaatcccagcgaa
tctgttattttgcaggcgcaaaatcgcctttctgaaataaagaatcgcattttggatcag
ccgaatccgccaatctgcacagctgaattaaaaaaactgcgccaatggcattggatgcac
ctgaatgccaccgaagatgagaaattactggtggccgagggagaggacgagttgattgat
ctggcggaacggatgcagcggcgattcccggatatacttccagagttatacaatccagag
tggtactacttcaagtatacggcgacacagagaactctgaaaagcgcggaaagtttcgcc
acgggcttgtttggccgtcatcgcatccatactgtacggtatccaccgcctttgcacgag
gatcctgttttgcggatggtcagttaccagaactgtatacacctggccgcctgtgctgcc
aatgagattctgcccatgaatgcgcagttgccggcggatctgtttaccagctgtctgaca
acacccatcaacatagcgctcaagtggtatgccatgcaggaaaaactgggcatggtgccg
cgtatccagagtgaactgatcgataagattccaggcaaagtcaacgaccggcgcaccatg
atgggagagctcaactggatcttcaccgccattacggacacgatagcgtggaacacactt
cccctcacgctctttcagcgcctgttccgccaggatctactggtggctagcctgttccgt
aacttcctgttggccgagcgcattctgcgcagccacgactgcactccagtttccctgccc
gccctgccgccttgctatcgccatccaatgtggaaggcctgggatctagtggtagatctg
gctctacagcagttgcccgaaattctcgatcacaatgcgccgtaccgccagctgccgttt
ttcgagcaccaactcacagccttccaggtgtggctggacagcgaatcggaatcgagaacg
ccaccggaacagctgcccattgtgctgcaggtcctactgtcgcaagtgcaccgcctgagg
gccctagagctgctggcccgatttctggatctcggtccgtgggccgttaatctcgccctg
ggcgtgggcatctttccatatgtgctcaagctgctgcagagttctacgcgcgaactgcgg
cccgttttggtgttcatttgggccaagatcctggccgtggatcccagctgccaggtggat
ctggtcaaggagtacaagtacttcctctctgtgctgcaggacacatccgtttccaaggag
catcgcacactctccgcctttgtactgtcctccatagtgcacaacttcctgctgggacag
actagtgcccttcagggtcccctactgtccatttgcctggagcagctaaacgacggaagc
tggctgttgcgccagtggcttgccatctgcctgggcatgttgtggcagaactttgaaaag
gctcgttggtcgggagcacgcgacctggcgcacgagaagctttacgttctgctgcgggac
aagattccggaagtaagagcggctgccgtcttcgccttgggcacatttatcagctccgtg
acggaccgcagcgaggagcaggcgaataacatcgatcgcatcattgccattaccatgctc
gagaccgtgggcgaggatatgtcgccgctagtccgcatggagttggccgccgctctgcaa
tggatggtagtactctttgagtcacagttcgtggccgtatatctagctgagcatatgcgc
ggtcacgtctccgccgcctcgttcgtgatgtgtcccgatccccgggagctgacatcttcc
acgcacagcctggagcgtcatgtgaccatccgcaggggagccagctccagctccatatct
aacatgggtggtgcgtcaactggctcgggcacaggatcatccagcaacccattgggtcgc
tcgaagagtggctctgccagttcgggcggaagaggagctgccggagctgcgggtggtaca
aacagcatacccttccagtcaattttcaccaaactgtggctgggcatctgtaatctggcc
caggatccgtttccccgcgtggcggccattgcccaggagattgttgaccatgtgagggat
acggcactgtgtcccattatggcggccaaggaagccaccatgtccaatgcatcggagaag
tgcagtagcctaagcgtaagcctcccgcccagtccaaatacgagggttaattacttgggc
ggtggcggtgcacctggaggagctggggcgactgcagaatcaccgcccgtcggagcagct
gcctcgggcgccagtcactgggcccaaaagctaaggctatcgggcagtggagcctgcgtg
gctgccggagatcctcaaaccattctgcagcgcaaactgcgcaccacctccatcaacgat
gagactgacagcggaccatcgtactcccgcggattctataagggctgtggcaagtggaaa
actgacgtcgataagaatcccgaaaccttggtcaacgcacgcaggtaccttgcggagccg
cagatgcggtcggcagtggagcagatacggagcagcacccggctaccggatcttcagccg
gaggacgttcagcttatgtatacggtgtgcgctttcgaaaccgcctggcatcgaccgcgt
cgcgactctggctccagatccacatacgaatccgtgtggtgtaacttcttcgacgtggcc
gccttggaggcgctggagttcttcaaggatctggaatactattggaacgatggatacggc
tacgaactgactcatcgcattgcctgtccggcaatcgcagatatgtttgcttccattggt
tcctctgaggagaaacagcagcgacgggccaacgccacgttgtacttcacgcactcgggc
acgcttcttaaattgctggcccacctagggttggcccgggacaataagccgctgacgcac
aagcactttgccagcgagcgtctttggcgcacaagccagatcgacgcgttcgcgaccaac
ttggcctttctacgttacgattgcgatgaggagaagccgcaagtcctggtgctgcatcag
gagcgagtggtgcgcctgcccggctgcccgcaggacaaggatctctgtccgctggccacg
ctgcgtcgcatttacgccaaaagcgtggaccactgcgaccgcgaggagatgtgccgtgtg
aaggccaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system