KEGG   Drosophila yakuba: Dyak_GE16484Help
Entry
Dyak_GE16484      CDS       T01068                                 

Gene name
dyak_GLEANR_17900
Definition
(RefSeq) GE16484 gene product from transcript GE16484-RB
  KO
K03103  
multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE16484 (dyak_GLEANR_17900)
   00562 Inositol phosphate metabolism
    Dyak_GE16484 (dyak_GLEANR_17900)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dyak_GE16484 (dyak_GLEANR_17900)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dyak_GE16484 (dyak_GLEANR_17900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 457 aa AA seqDB search
MLSQFYCLCLSLLLYFFVGVTWAEEGDCRRLKRADIEGRLSTKTPYRAIANYDETPPKYA
GCHPTRIWSIIRHGTRNPSESVILQAQNRLSEIKNRILDQPNPPICTAELKKLRQWHWMH
LNATEDEKLLVAEGEDELIDLAERMQRRFPDILPELYNPEWYYFKYTATQRTLKSAESFA
TGLFGRHRIHTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRYLAEPQMRSAV
EQIRSSTRLPDLQPEDVQLMYTVCAFETAWHRPRRDSGSRSTYESVWCNFFDVAALEALE
FFKDLEYYWNDGYGYELTHRIACPAIADMFASIGSSEEKQQRRANATLYFTHSGTLLKLL
AHLGLARDNKPLTHKHFASERLWRTSQIDAFATNLAFLRYDCDEEKPQVLVLHQERVVRL
PGCPQDKDLCPLATLRRIYAKSVDHCDREEMCRVKAN
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctaagccaattttactgtttgtgtttgtcgctcctcctctacttcttcgtgggcgtg
acgtgggctgaggagggggactgccgccgccttaagcgcgcagatatcgagggcagactg
tccacaaagaccccgtacagagcgatcgccaattacgacgaaacgccgccgaaatacgcc
ggttgccatccgacgcgaatttggtccatcatccgacacggaacacgaaatcccagcgaa
tctgttattttgcaggcgcaaaatcgcctttctgaaataaagaatcgcattttggatcag
ccgaatccgccaatctgcacagctgaattaaaaaaactgcgccaatggcattggatgcac
ctgaatgccaccgaagatgagaaattactggtggccgagggagaggacgagttgattgat
ctggcggaacggatgcagcggcgattcccggatatacttccagagttatacaatccagag
tggtactacttcaagtatacggcgacacagagaactctgaaaagcgcggaaagtttcgcc
acgggcttgtttggccgtcatcgcatccatactgtacggtatccaccgcctttgcacgag
gatcctgttttgcggttctataagggctgtggcaagtggaaaactgacgtcgataagaat
cccgaaaccttggtcaacgcacgcaggtaccttgcggagccgcagatgcggtcggcagtg
gagcagatacggagcagcacccggctaccggatcttcagccggaggacgttcagcttatg
tatacggtgtgcgctttcgaaaccgcctggcatcgaccgcgtcgcgactctggctccaga
tccacatacgaatccgtgtggtgtaacttcttcgacgtggccgccttggaggcgctggag
ttcttcaaggatctggaatactattggaacgatggatacggctacgaactgactcatcgc
attgcctgtccggcaatcgcagatatgtttgcttccattggttcctctgaggagaaacag
cagcgacgggccaacgccacgttgtacttcacgcactcgggcacgcttcttaaattgctg
gcccacctagggttggcccgggacaataagccgctgacgcacaagcactttgccagcgag
cgtctttggcgcacaagccagatcgacgcgttcgcgaccaacttggcctttctacgttac
gattgcgatgaggagaagccgcaagtcctggtgctgcatcaggagcgagtggtgcgcctg
cccggctgcccgcaggacaaggatctctgtccgctggccacgctgcgtcgcatttacgcc
aaaagcgtggaccactgcgaccgcgaggagatgtgccgtgtgaaggccaactaa

DBGET integrated database retrieval system