KEGG   Drosophila yakuba: Dyak_GE16619Help
Entry
Dyak_GE16619      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dya  Drosophila yakuba
Pathway
dya00220  Arginine biosynthesis
dya00330  Arginine and proline metabolism
dya01100  Metabolic pathways
dya01230  Biosynthesis of amino acids
Module
dya_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dyak_GE16619
   00330 Arginine and proline metabolism
    Dyak_GE16619
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dyak_GE16619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase PAS_8
Motif
Other DBs
NCBI-GeneID: 6523809
NCBI-ProteinID: XP_002099684
FlyBase: FBpp0261629 FBgn0234120
UniProt: B4PX06
Position
X
AA seq 363 aa AA seqDB search
MWWSRKFASRSLRLHRVKSTGSSGSTRSTRSTGSTVPRDPEQSLGIIGVPFAKGQGKQGV
ELAPDLLRQSSLRQVIQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACN
RALIEQVKLMLAENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQS
GNIHGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRY
YAMDTIDRVGVPKIIEMTLDALDPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGIS
IVEALRDTKRVQGVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGRWSNIDTGIL
GSD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgcctcaaggtctctccgcctccaccgggtcaagagcacc
ggaagcagcggaagcaccagaagcactagaagcactggaagcacagtccccagggatccg
gagcaatctctgggcatcattggagtgcccttcgccaaggggcagggaaaacagggcgtg
gaactggctcctgatcttctccggcagagcagtctgcgccaggtgattcagagcagtcac
gatggcctggtgatacgggactacgggaatctgcagtacgccgtagacgagccccttctc
cagcagcagcgtgtgcactaccaccacatccgcaactacgcggacttcatggcctgcaat
cgggcattgattgagcaggtgaaactgatgctcgcggagaacacgcagtttctggccatt
ggtggcgaccatgcgatcggcttcggatccgtggccggacacctgcaacacacgccgaac
ttgtccctggtgtggatcgacgcacatgcggacatcaatctgcacagcacctcgcagtcg
ggcaacatccacggcatgcccgtctcctttctgctggaacagctccgtaacacctggcag
cacgccggcctccaggagatcgcgcccaactgcttgcccaaggatcagttggtttacatc
ggactccgggacattgacccctacgaggcgttcatcctaaacaaagtcggaatacgctac
tatgcaatggataccatcgaccgggtgggcgtgcccaagatcatcgagatgacgctggac
gccctcgatccgcagaacaagatccacgtcagcttcgacatcgacgccctggacagcaat
gtggcgcccagcacgggcaccgcggtgcgcggcggcctcacgctccgcgagggaatcagc
atcgtggaggcactccgggacaccaagcgggtgcagggcgtcgatctggtggagatcaac
ccgaagctgggcagcgagcgcgacgtgcgcaccaccgtggagtccggcctggagatactg
aagagcatgttcggctaccgacgctcggggcgctggagcaacatcgacaccggaatcctt
ggcagcgattaa

DBGET integrated database retrieval system