KEGG   Drosophila yakuba: Dyak_GE16624Help
Entry
Dyak_GE16624      CDS       T01068                                 

Definition
GE16624 gene product from transcript GE16624-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dya  Drosophila yakuba
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dyak_GE16624
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dyak_GE16624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 304 aa AA seqDB search
MAQTEVLVFGSAIIDFISYTPRLPRPGETLHGHRFQTGYGGKGANQCVAAARQGSRTALV
AKLGADSFGSDYLRHLREERVNVDHVEQLADQTTGVAQIAVSDGGENNIIIVVGANNQLS
SSDVSAAEVLFREAKVLVCQLETPIEATLTALKSFRGVSIVNAAPAMADTPPELLQLASI
FCVNESEAALMTQMSDIGNVEQAEDAVGKLIEAGANTVIITLGKLGAVFGSADSKGVCQH
VAAPDVLPEKVVDTTGAGDAFIGALAHNLARHPNGQLADHIVAACAVASQSVQLPGTQSS
FPRA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaacggaggtgctggtctttggctcggccatcatcgacttcataagctacaca
ccccggctgccgagacccggagaaacgcttcacgggcaccgctttcagaccggctacggc
ggcaagggcgccaatcagtgtgtggccgccgcgcgccagggatcccgcacagctctggtg
gccaaattgggcgcagacagctttggcagcgactacttgcggcatctgcgcgaggagcgg
gtcaatgtggaccacgtcgagcagctggcggaccagacgacgggcgtggcccagatagcc
gtgtccgatggcggcgagaacaacattatcatcgtggtgggcgccaacaatcagctgagc
tcatccgacgtctccgcggcggaggtgctcttccgggaggccaaggtgctggtctgccag
ctggagacgcccattgaggccaccctgacagccctgaaatccttccggggcgtgtccatt
gtgaacgcggctcctgccatggcggacacgccccctgagctgctccagttggccagcatc
ttctgtgtgaacgagagcgaggcggccctaatgacccagatgagcgacattgggaacgtg
gagcaagccgaggatgcggttggaaagctgatagaggcaggtgccaatacggtgatcata
actctagggaaactgggagccgtcttcggctccgccgattccaagggcgtgtgccagcat
gtggctgcaccagatgtgctacccgagaaggtggtggacacgacgggggccggcgacgcc
ttcattggggccttggcccacaacttggcccgtcatccaaatgggcaactggcggaccac
atagtcgccgcctgtgccgtggcctcgcaatccgtgcagctccccgggacgcagtccagc
ttcccacgggcttag

DBGET integrated database retrieval system