KEGG   Drosophila yakuba: Dyak_GE16638Help
Entry
Dyak_GE16638      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dya  Drosophila yakuba
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    Dyak_GE16638
   00514 Other types of O-glycan biosynthesis
    Dyak_GE16638
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     Dyak_GE16638
Glycosyltransferases [BR:dya01003]
 O-Glycan biosynthesis
  O-linked Man type
   Dyak_GE16638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
X
AA seq 766 aa AA seqDB search
MAASVVKAPKCPRRGSVKDVAQGAPRTASTSSKEANWNWWLLLATVFLVTFATRFYKVTE
PDHICWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYNGTFPFEKPGDKYNE
TRYQGMRYFCTTLGALIMPMGFDTVYDLTRSHEAALLAAAYLVFDVGLLTLNQYILLDPI
LLFFMMASVWGMVKISKSTASGGSYGLRWWFWLFLTGTMLSCTISVKFVGLFVVLLVGLH
TATELWLILGDLGQPILETAKQLACRAITLIVWPILLYVLFFYIHLSVLNRSGNGDGFYS
SAFQSRLIGNSLYNASMPRDVAYGSVVTIKNHKTGGGYLHSHYHLYPKGSGARQQQVTTY
THKDENNRWQIRPHNKQNLPKGKPQILRHGDIVRLTHVATKRNLHSHNEPAPMTKKHLQV
TGYGELGVGDANDAWRVLIVGGKVNETVHTVTSRLKFIHLLQNCALTSSGKQLPKWGFEQ
QEVSCNPNVRDKYSQWNVEDNEHKLLTSVSFSVYAPGFFARFLESHAVMLQGNAGLKPKE
GEVTSRPWQWPINYRGQFFSGSSYRIYLLGNPLIWWSNLVFLALFVAVFLFNAVVQQRRA
GFARSAAQDQPVLAPDSETVAQGEESEPSTTDVCSCCLPAEEKVPKAVPGGSLEAPNPAQ
SLRAAAWLFVGWVLHYLPFWAMGRVLYFHHYFPALIFNSLLTGVMFNYIMRVLPKWIHHV
VLGLVLSILVYSFAVFSPLAYGMSGPLANEPNSTMHNLKWLSTWEF
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgagtgttgtcaaagcgcccaagtgccccagacgagggtcagtcaaggatgtg
gcccaaggcgcacctagaaccgcgtccacgtccagcaaagaggccaattggaactggtgg
ctgctgctggccaccgtcttcctggtgaccttcgccacccgcttctataaggtcaccgaa
ccggatcacatatgctgggatgagacgcacttcggcaagatgggcagttggtacatcaac
aggacctttttcttcgacgtccatccgccgctgggcaagatgctcattggcctctctggc
tacttgacgggctacaacggaacgtttcccttcgagaagccaggcgacaagtacaacgag
acgcggtaccagggcatgcgatacttctgcaccacgctgggagccctgatcatgcccatg
ggattcgacaccgtctacgacctgacccgctcccatgaagctgccctgctcgcggctgcc
tatctcgtgttcgatgtgggtctcttgacgctgaaccagtacatcctgctggaccccatt
ctgctgttcttcatgatggcctccgtgtggggcatggtgaagatttccaagtccacggcc
tccggaggatcgtacggcctgcgctggtggttctggctcttcctcaccggcaccatgttg
tcctgcacgattagcgtgaagtttgtgggcctgtttgtggtgctgctggtcggtctgcac
acggccactgagctgtggctcatcctcggcgacttgggacagcccattctggagaccgcc
aagcagttggcctgccgggccatcaccctgattgtctggcccattctcctctacgtcctg
ttcttctacatccacctgagtgtgctcaaccgcagcggcaacggagatggcttctacagc
tcggcctttcagtcgcggctgatcggcaactcgctctataatgccagcatgccccgagat
gtggcctacggatcggtggtgaccatcaagaaccacaagacgggcggaggctacctgcac
tcgcattaccacctgtatcccaagggatcgggcgccaggcagcagcaggtcaccacttac
acgcacaaggacgagaacaacaggtggcagatcaggccgcacaacaagcagaatctaccc
aagggcaagcctcagatcctccggcacggcgacatcgtccgcctgacccacgtggccacc
aagaggaatctgcactcccacaacgaaccggcgcccatgaccaagaagcacttgcaggtc
accggctatggcgagttgggcgtaggcgatgccaacgacgcctggcgcgtcctgattgtg
ggcggcaaggtcaacgagacggtccacacggtcacctcccgcctcaagttcatccacctg
ctgcaaaactgcgccctgacctccagtgggaagcagctgccgaagtggggcttcgagcag
caggaggtgtcctgcaatcccaacgtgcgggacaagtactcgcagtggaacgtcgaggac
aacgagcacaagttgttgaccagtgtgagcttcagcgtgtatgcccccggcttcttcgcc
cgcttcctcgaatcccacgccgtgatgctgcagggcaacgcaggactcaagcccaaggag
ggcgaggtcaccagcagaccctggcagtggcccatcaactacaggggccagttcttctcc
ggcagcagctaccgcatctacttgctgggaaaccccttgatctggtggagcaacctggtc
ttcctggcactcttcgtcgcggttttcctcttcaacgccgtcgtgcagcaaagaagagct
ggcttcgcccgatctgcagcccaggatcaaccagtactagctcccgattcggagacggtg
gctcagggcgaggagagcgagccctcgaccacggacgtctgcagttgttgtcttccggcg
gaggagaaggttccaaaggccgttcccggtggctccctggaggcacccaacccggcgcag
tccttgcgggcggccgcctggcttttcgtgggctgggtgctccactatctgcccttctgg
gcgatgggcagggtgctctacttccaccactacttcccggccctgatcttcaactccttg
ctaacgggcgtcatgtttaactacatcatgagggttctgcccaagtggatccaccacgtc
gtcttgggactggtgctctcgatcctggtctacagttttgccgtcttctcgccactggcc
tatggaatgagtggtcctctggccaacgaacccaactctacaatgcacaatctcaagtgg
ctttccacctgggagttctag

DBGET integrated database retrieval system