KEGG   Drosophila yakuba: Dyak_GE16675Help
Entry
Dyak_GE16675      CDS       T01068                                 

Definition
GE16675 gene product from transcript GE16675-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dya  Drosophila yakuba
Brite
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dyak_GE16675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 228 aa AA seqDB search
MGSVGSRQLNPAQLCDHQQATGLSAEQLEQLHTRFRSLDRHQHGYLTPTDLLRIPQLSLN
PLHRQIIDGFFPSREPSARIGFKQFVDTCSTMLVPQFGRGSVRRCDGRVQKLRLLSKMFD
TRRSGCITRSDFRQIMCSIVNLTWGQKQDQGSQEKLSDHRLPEVEAELQLLEQQAFGFSS
CDKISYAEFEERLVSADVDGRLSIAKWLEDDDEGDAEAEAGMEVGSSP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgtaggaagtcgccagctcaatcccgcccaactgtgtgaccaccagcaggcc
acgggactgtccgccgagcagctggagcagctgcacacgcggtttcgcagcttggatcgc
caccagcacggctatctgacgcccaccgacttgctgcgtattccgcagctctcgctcaac
ccgctccaccgccagatcatcgacggcttcttccccagccgtgagcctagcgcgcgtatc
ggcttcaagcagttcgtggacacctgctccaccatgttggtgccacagtttggccgcggc
tcagtgaggcggtgcgacgggcgcgtccagaagctacgcctcctgtccaagatgtttgac
acccgtcgcagcggctgcatcacacgctccgacttccgccagatcatgtgcagcatagtc
aatctgacctggggacagaaacaggatcagggaagtcaggagaagctttccgatcaccgt
ttgcctgaggtggaggccgagctgcaactcctagagcagcaggcctttggcttctccagc
tgcgacaaaatctcttatgcggagttcgaggagcgactggttagtgcggacgtcgacgga
cggctgtcgatcgccaagtggctggaggacgatgacgagggcgatgccgaggcagaggcc
ggaatggaagttggctcaagcccgtaa

DBGET integrated database retrieval system