KEGG   Drosophila yakuba: Dyak_GE16684Help
Entry
Dyak_GE16684      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dya  Drosophila yakuba
Pathway
dya04068  FoxO signaling pathway
dya04140  Autophagy - animal
dya04150  mTOR signaling pathway
dya04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE16684
   04150 mTOR signaling pathway
    Dyak_GE16684
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dyak_GE16684
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dyak_GE16684
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dyak_GE16684
Protein kinases [BR:dya01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   Dyak_GE16684
Membrane trafficking [BR:dya04131]
 Autophagy
  Other autophagy associated proteins
   Others
    Dyak_GE16684
Mitochondrial biogenesis [BR:dya03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dyak_GE16684
  Mitophagy factors
   Other mitophagy factors
    Dyak_GE16684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Androgen_recep Kdo APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 6523912
NCBI-ProteinID: XP_002099785
FlyBase: FBpp0261694 FBgn0234181
UniProt: B4PXP0
Position
X
AA seq 582 aa AA seqDB search
MPQMRAAAAEAVAAGSANGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVI
DTYAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFF
VAGSPPPPPPPPVPQSSMDHQAPLATVTVGGGTAASSGTATPVPPVAGGTPSGTIPIRPH
PERIAPMRDRQLAMSVQTSGGGAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRA
MKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVEQGDD
VIMESLTPPPLSVSGVMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatgagggctgcggccgctgaggcggtggccgccggcagcgccaatggccag
ccgctagtcaagatcggacactacctgctgggcgccaccctgggcacgggcacctttggc
aaggtgaagatcggcgagcaccagatcacccgggtcaaggtggccgtcaagatactcaat
cggcagaagatcaagagcctggacgttgtgggcaagatccggcgagagatccagaacctg
aagctcttccgccacccgcacatcatcaagctgtaccaggtcatctccacgccctcggac
atcttcatgatcatggagtacgtgagcggcggagagctgttcgactacatcgtaaagcac
ggcaaactgcaggagcaccaggcgcgccgcttctttcagcagatcatctcgggcgtggac
tattgccaccggcacatgatcgtgcatcgggatctgaagccggagaacctgctgctcgac
cacaacatgcacgtgaagatcgccgacttcgggctctcgaacatgatgctcgacggcgag
ttcctgcgcacctcgtgcggctcccccaactacgcggcgcccgaggtgatttccggcaag
ctgtacgccggtcccgaggtggacatctggtcgtgcggcgtcatcctgtacgccctgctg
tgcgggacgctgccgtttgacgacgagcacgtgcccacgctgttccgcaagatcaagtcg
ggcattttcccgattcccgagtacctcaacaaacaagtggtcaacctggtgtgccagatg
ctgcaagtggacccgctcaagcgggccaacatcgaggagatcaagaagcacgagtggttc
caaaaggacctcccggcctacctcttcccctcgtccatcgagcaggactccaatgtgatc
gacacctacgccgtggcagaggtctgcaccaagtttggcgtcaaggagaccgaggtgcac
aactcgctgctcagcggcgatccgcacgatcagctggccatcgcctaccatctgatcatc
gacaacaaacgcttcgccgatgacgcggccaaccaaataaacgagatcaacaacttcttt
gtggccggctcgccaccaccgccgccgcctccgcccgttccgcaatcatcaatggaccac
caagcccctctggccaccgtgaccgtgggcggaggcactgcagctagctcgggcacggcc
acaccagtgcccccagtggctggaggcactcccagcggcaccatccccatacgaccgcat
ccggagcggattgcgccgatgcgggaccgtcaactggccatgtccgtgcagacatctggc
ggcggagccttcccggagaaaaccgcacgcggcggtactcccatcaagcgcgccaagtgg
catctgggcatccggtcgcagagcaagccgaacgacattatgctcgaggtgtaccgggcg
atgaaggcactcagctacgagtggaagatcatcaatccgtaccacgttcgggtgcgcagg
cagaacgtgaagaccggcaagttctcgaagatgtcgctgcagctgtaccaggtggatgcc
aagagctatctgctcgacttcaagtcgctgaccaacgacgaggtcgagcagggcgacgac
gtcatcatggagagccttactccgccgccgcttagcgtctccggggtaatgccgctgcag
ccgaccgggcaccacaccatggagtttttcgaaatgtgcgccgccctgatcattcaactg
gctcgctga

DBGET integrated database retrieval system