KEGG   Drosophila yakuba: Dyak_GE16726Help
Entry
Dyak_GE16726      CDS       T01068                                 

Definition
GE16726 gene product from transcript GE16726-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE16726
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dyak_GE16726
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE16726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1137 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQQQQQQQQTPQQQQNSPPQLPKFKNLIQPQLH
AVGAVTQLPSENGNVPPQQLLADSSSTSFGDAEAMGIDDESKEDQFRSETTFSFTVENVV
QLKSQRLSPPVYVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKSHKPD
AQPFSRARIKHLFYSKENDYGYSNFITWPELQDSDKSYVHNNSITLEVHVIADAPHGVLW
DSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSTKSVGLSLQRVFH
ELQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTTLEGTIPGLFE
GKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHG
LQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEQINLDRYLAESEKTSA
DYVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEIS
FHAKCSNAYMLVYIRQSELERVLGDIPENEISSDLVERLDLEKRIEMARRKERSEANLYV
SVHVNLEEYFDDQHKGRLFDLEKAHPRIFRIKQNQTVDELVDMFVKGFGVSRERMRMWNM
CTAQPQKFLHFDFVAEASRAIEQIPTSQKPWVIWLELAWPDVSGPLPSFNPKTEVLLFLK
YYDARNKRLNYIGCTQQPHTRRLIDLVPEVNRKLGFDADTELTIFDESADKKLVNLNEPI
ESVLFIPQDHLQGHILIFERENVDAKLDLPTVQDYFHDIVHRVEIIFSDKCNPNEPDFTL
KLSGRYNYDQLTNAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKL
STPKRIFYQRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKI
TFAENSRRKLRLMKVSHHKIVAICKDDIPLDTLLKTNESITTTQGGQKAYRIEEVPAEEM
QLAENEFLIPVGHFSKELYNSFGVPFLAKARHGEPYGALKQRIQRRLNVPDKEWENYKFS
VISMGHNSDVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcagtctattgaagcaatggacacccaggacacccaagaggtc
gagatcctcaccagtgacctccagcagcagcagcaacaacaacaacagactccgcaacag
cagcagaattcgccgcctcaattgcccaaattcaaaaatcttatccagccacaattgcac
gccgttggcgctgtaacccagttgcccagcgagaacggcaatgtgccgccacagcaacta
ttggcggatagcagctccacttcgttcggcgacgccgaggccatgggcattgacgatgag
tccaaggaggatcagttccgctcggagaccacattctcctttaccgtcgagaatgtagtt
caattgaaatcgcagagactgtcgccgccagtgtatgtccgcatgttgccatggagaatt
atggtcatacccaatgatcgtgcgctgggcttcttcctgcaatgcaatggtgagaatgat
tcgcccacctggtcatgcaatgccattgctgagctgcgtttgaagagccacaagccggat
gcacagccattcagccgtgctcgcattaagcatttgttctactccaaggagaacgactat
ggctactcgaacttcatcacctggccggagctgcaggattccgacaagagctatgtgcac
aacaacagcatcaccctggaggtgcacgtaattgcggatgcaccgcatggcgttttgtgg
gactcgaagaagcacacaggctatgtgggcctcaaaaatcagggcgcaacctgctatatg
aactcgctgctgcagacattgtacttcaccaattctctaagactgtctgtgtatcgcata
cccacagaggctgacgatagcaccaaatcagttggactatcgctgcagcgtgtgtttcat
gaactgcagtttggtgaccgccccgtgggcaccaagaagctaaccaagtcctttggctgg
gagacgctcgattcgttcatgcagcacgatgtccaggagttccttcgcgtgctgctcgac
aagctcgagtcaaagatgaagggcacaacactggagggcaccataccgggtctgttcgag
ggcaaaatgtcttcgtacattaaatgcaagaacgttgactacaacagcacacgctacgag
acgttctacgacatccagctgaacatcaaggataagaagaacatctacgagtccttccag
gattacgtagctcccgagacgctggagggtgacaacaaatacgatgctggtgtgcatggc
ttgcaggaagccagcaagggcgtaatcttcacttcattcccacccgttttgcatctgcac
ctgatgcgcttccagtacgatcccgtcacggacagctcgattaagtacaacgatcgcttt
gagttctacgaacagatcaatctggatcgctacctagccgagagcgagaagacctcggcg
gactacgttctgcacgccgtcctggtgcactctggcgataaccatggcgggcactatgtg
gtcttcattaatccaaaggctgacggacgttggtttaagttcgacgacgatgtggtctcc
agttgccgcaagcaggaggcgatcgaacagaactacggcggtatggacgacgagatctcg
ttccatgcgaagtgcagcaatgcctatatgctggtctacatccgccaatcggagttggag
cgcgtccttggcgacataccagagaacgagatctcaagcgacctggtggagcgcctcgat
ctggagaagcgcatcgaaatggcgcgacgcaaggagcgcagcgaggccaacctttatgtg
tccgtgcacgtgaacctcgaggagtacttcgacgaccagcacaagggtcgcctcttcgat
ctggagaaagctcatccgcgcatcttccgcatcaagcaaaatcagactgtcgacgagctg
gtggacatgtttgtcaagggtttcggagtgtcgcgcgaacgcatgcgaatgtggaacatg
tgcaccgcccagccccaaaagtttttgcattttgatttcgtggcggaggcgtcacgcgcc
atcgagcagataccgacctcacagaaaccgtgggtcatctggctggagctagcctggccg
gatgtttctggtcccctgccgtcctttaatcccaagaccgaagtcctgctgttcctcaag
tactatgatgcgcgtaacaagcgcctgaactacattggatgtacccagcagccgcacacc
cgccgccttatcgatctggtgccggaggttaatcggaaactgggcttcgatgcggacacc
gagctgaccatcttcgatgagtccgccgacaagaagctggtcaatctgaacgagcccatt
gagagtgtgctgttcataccgcaggaccacctgcaaggccacatcctaatcttcgaacgt
gaaaacgtcgacgccaaactcgacctgcccacggtgcaggactacttccatgatatcgtc
catcgcgtcgagatcatcttcagcgacaaatgtaaccccaatgagccggactttacgctg
aagctgtccggtcgctacaactacgatcaactcaccaatgcggtggccgagcgcttgaat
accgatccacagaagctgcagttttttatgtgcatcaacaactacaaggaaacggcgggc
aatgcagtgccctacacatttaagggaaccatcaaagatctggtgtcctacaccaaactg
agcacgcccaagcgtattttctaccagcgcctgtcgctcagcatccatgagctggacaac
aagaagcagtttaaatgcgtctgggtgagcagcgacctcaaggacgagaaggaactggtg
ctgtaccccaacaagaacgatacggtaaagggactgctggaggaggcggccaagaagatt
acatttgcggagaacagtcgtcgcaagttgcgcctgatgaaggttagccatcataaaatc
gtggcgatatgcaaggatgatataccgctggatacgctgctaaagaccaacgagtcaatc
acgaccacacagggcggtcaaaaggcttatcgcatcgaggaggtgccggcggaggagatg
cagctggcggagaacgagttcctcatcccagtgggccacttcagcaaggagctgtacaac
tcgttcggcgtacccttcctagccaaggcacgccacggcgagccgtatggtgcgctaaag
cagcgcatccagcggcgtctgaatgtgccggacaaggagtgggaaaactacaaattctcc
gtgatctccatgggccacaattcggatgtgaacgacaatacgcccgtcgacctggaggtg
tatcgctcgtggaccagcggacagttgcccttctttggtttggatcacatcaacaagtcg
cgcaagcgcagctcgcttaacttttccgagaaggccatcaagatctacaactag

DBGET integrated database retrieval system