KEGG   Drosophila yakuba: Dyak_GE16739Help
Entry
Dyak_GE16739      CDS       T01068                                 

Gene name
dyak_GLEANR_18132
Definition
(RefSeq) GE16739 gene product from transcript GE16739-RA (EC:3.4.19.-)
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE16739 (dyak_GLEANR_18132)
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C86
   Dyak_GE16739 (dyak_GLEANR_18132)
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    Dyak_GE16739 (dyak_GLEANR_18132)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 221 aa AA seqDB search
MESPSARTLGNSLADDCGNGNGYGNGNGNTTMMPHGIYHERQTRHLCGLHALNNLFQGPD
TFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDRRRDPHCL
NLSAIFGFILNVPAQMSLGYYIPLPFQMRHWLALRRLNGSYYNLDSKLREPKCLGTEQEF
LEFLRTQLQLDHELFLVLNEVQADSKDAKTQQRWLLPQFRD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcccagtgctcgaacactcgggaattctctggcggatgactgcggcaatggg
aacgggtatgggaatggaaacgggaacaccacgatgatgccacatggaatctaccatgag
cgacagacacgccacctttgcggcctccacgccctgaacaacctgttccagggccccgac
acgttctccaaatcggaactggacgactactgcaccacactgaccccgcgcaactggctg
aatccgcaccgttcctggatcggctggggcaactacgacgtgaatgtgatcatgtacgcc
ctgcagcagcggaactgcgaggcggtgtggttcgaccgccggcgggatccacactgcctc
aatctgagcgccattttcggcttcatcctcaatgtgccggcccagatgagcctgggctac
tacatcccactgcccttccagatgcgccactggctggcactgcgtcgcttgaacggcagc
tactacaacctggactctaagctgcgggagcccaagtgcctgggcaccgagcaggagttc
ctagagtttcttcgcacccagctgcagttggaccacgagctattcctggtgctgaacgag
gtgcaagcggactcgaaggacgctaagacccagcaacgttggctgttgccgcagttcagg
gattaa

DBGET integrated database retrieval system