KEGG   Drosophila yakuba: Dyak_GE16739Help
Entry
Dyak_GE16739      CDS       T01068                                 

Definition
GE16739 gene product from transcript GE16739-RA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 221 aa AA seqDB search
MESPSARTLGNSLADDCGNGNGYGNGNGNTTMMPHGIYHERQTRHLCGLHALNNLFQGPD
TFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDRRRDPHCL
NLSAIFGFILNVPAQMSLGYYIPLPFQMRHWLALRRLNGSYYNLDSKLREPKCLGTEQEF
LEFLRTQLQLDHELFLVLNEVQADSKDAKTQQRWLLPQFRD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcccagtgctcgaacactcgggaattctctggcggatgactgcggcaatggg
aacgggtatgggaatggaaacgggaacaccacgatgatgccacatggaatctaccatgag
cgacagacacgccacctttgcggcctccacgccctgaacaacctgttccagggccccgac
acgttctccaaatcggaactggacgactactgcaccacactgaccccgcgcaactggctg
aatccgcaccgttcctggatcggctggggcaactacgacgtgaatgtgatcatgtacgcc
ctgcagcagcggaactgcgaggcggtgtggttcgaccgccggcgggatccacactgcctc
aatctgagcgccattttcggcttcatcctcaatgtgccggcccagatgagcctgggctac
tacatcccactgcccttccagatgcgccactggctggcactgcgtcgcttgaacggcagc
tactacaacctggactctaagctgcgggagcccaagtgcctgggcaccgagcaggagttc
ctagagtttcttcgcacccagctgcagttggaccacgagctattcctggtgctgaacgag
gtgcaagcggactcgaaggacgctaagacccagcaacgttggctgttgccgcagttcagg
gattaa

DBGET integrated database retrieval system