KEGG   Drosophila yakuba: Dyak_GE16747Help
Entry
Dyak_GE16747      CDS       T01068                                 

Gene name
Dyak_Plc21C
Definition
GE16747 gene product from transcript GE16747-RA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dya  Drosophila yakuba
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dyak_GE16747 (Dyak_Plc21C)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE16747 (Dyak_Plc21C)
   04070 Phosphatidylinositol signaling system
    Dyak_GE16747 (Dyak_Plc21C)
 Organismal Systems
  Sensory system
   04745 Phototransduction - fly
    Dyak_GE16747 (Dyak_Plc21C)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Dyak_GE16747 (Dyak_Plc21C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1313 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIRWDDDSGTGTPVTMRVDAKGFFLYWVDQNNELD
ILDIATIRDVRTGQYAKRPKDNKLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCT
RRDIAQLWSDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSIPVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRY
LMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNMDLPPPAMLRRKIIIKNKKKHHHHHHHHHHKK
PAQVGTPAANNKLTTANSVDAKAAQQVALAAAQEDGGVTRSTANGDVATGTGTGSGHAPP
LQQIRQSSKDSTGSSDSDSSSEDESLPNTTPNLPSGNEPPPEKAQKETEAGAEISALVNY
VQPIHFSSFENAEKKNRCYEMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGTRFDS
SNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRLDPFA
ESTVDGIIAGTVSITVLSGQFLTDKRANTFVEVDMYGLPADTVRKKFRTKTVRDNGMNPL
YDEEPFVFKKVVLPELASIRIAAYEEGGKLIGHRVLPVIGLCPGYRHVNLRSEVGQPIAL
ASLFLCVVVKDYVPDDLSNFAEALANPIKYQSELEKRDIQLSVLTDEAEALGNADEDLSK
SFVFVQVGGQKKELRPVESLATSPKHRASISAAAAMSVDVTVDRTDGGRGEDSVSIVAPS
IQHQHSLDQSVSTSIRQVESSQFDVDLVLAEPLEKILDHKSVKEKRLEMEKKLESLRKKH
DKEKVKIAGQKSSPLEGKKPKFAITNKLVKRLSNKSLNCLSPHSEPGIEIPACPLDLGDS
SEESAAADAGEDLAGGSSSLDGRTQESRLRSACREYTSQYRELQEKYHEAIYSAAEKVLK
TSQTGQTKQLKASLDKVTGEVMHQLQEARRNEVKNLATVHRDRDELIRMKREVASSVVER
GVAERVRLKQTFDRRTDELQKQHDSVRNSLAEHRSKARQILDKEAESRSCVSSSGFLVLF
HGPHHHGCSGSGSSALSGNNLTLNLDAGAAGSHSAISPARSHNSIAAAAEMKT
NT seq 3942 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcgccggaggaacgtacatctccaccgccagcgtggaggtaccacaagctctg
caagatggcgagaagttcattcgatgggatgatgactcgggcactggaacaccggtcaca
atgcgcgtcgacgccaagggcttctttctctactgggtcgaccaaaacaacgagctggac
atcctggatatagccaccattcgcgacgtacgcacaggacagtacgccaagcggccaaag
gacaacaagctgcgccagattgtgacgctgggcccccaggacacgctggaggagaagacg
gtgaccgtgtgccacggctcggatttcgtcaacatgacgttcgttaacttctgctgcacc
cgccgggacattgcccagctctggagcgacggactcatcaagttggcctacagcttggcc
cagctcaacgggtcggcgattatgttcctgcagaaggcccacaccaaactgtgtctccag
gtggacaagagcggtcgcataccagtgaaaaacatcataaaacttttcgcccaaaacaag
gaggatcgcaaacgtgtcgagaaggcgctggacgtgaccggtttgccgtcgggaaaggtc
gatagcataccggtgtccaaatttcaattcgaggacttttacaatttgtacaaatatctc
acgcagcgctcggaggtggagcgcctcttcgacagcatcgtcggcaactcgaagcgcaag
tgcatgtccatcgcccaactggtggagttcctgaacaagacgcagcgtgatccccgcctc
aacgagatcctctatccctacgcgaatcccgcccgcgccaaggagctcatccagcagtat
gagcccaacaagttcaacgcgcaaaagggccaactcagcctggatggctttttgaggtac
ttaatgggcgacgacaatcccatcatggcgcccagcaagctcgatctctgcgatgacatg
gaccagccgatgtcgcactacttcatcaactcctcgcacaacacctacttgacgggccac
cagctgactggcaagtcgtccgtggagatttacaggcagtgcctcctggcgggatgcaga
tgcgtcgagcttgacttttggaatggacgcactgaggagccggtcattgtccacggctac
acgttcgtgcccgagattttcgccaaggacgtgctggaggccatcgcagagagtgcattt
aaaacatccgaataccctgtgatattgagctttgagaatcactgcaaccctaggcaacag
gcgaaaattgcgaactattgtcgcgaaatattcggcgatatgctgctcgacaagccgctg
gactcgcatccgctggaaccgaacatggacttgccaccgccggcgatgctgcgccgcaag
atcatcatcaagaacaagaagaagcaccaccaccaccatcaccatcatcaccacaaaaag
ccggcgcaggtgggcacgccggcagccaacaacaaactgactacagcgaactcagtggat
gccaaggcggcgcaacaagtcgctctggcggccgcgcaggaggatgggggcgtgaccagg
agcaccgccaacggggacgttgccacgggaacaggaaccggaagtggacacgcaccgccg
ttgcaacaaatccgccagagctccaaagacagcactggatcctctgattcggacagctcc
tcggaggatgaatccctgcccaacaccacgcccaatttgcccagcggcaacgaacctccg
ccggaaaaggctcagaaggaaacggaggctggggcagagatttcagccttggtcaactat
gttcaacctatccattttagctcctttgaaaatgcggaaaaaaagaatcgctgctacgaa
atgtcttcgttcgatgagaaacaggcaacgacactgttgaaggagcgaccgattgagttt
gtgaactacaacaagcaccagttatctcgagtctatccggcgggaactcgcttcgatagc
tccaactttatgccgcagttgttctggaatgccggatgtcagctcgtggcactcaacttc
caaaccctcgatcttgccatgcaactcaacttggggatcttcgagtacaacgctcgttcc
ggttatctactcaagccggagtttatgcgccgctcagatcgcagactggatcccttcgca
gagagcactgtggatggcatcatagcaggcacagtatcgatcacggttttatcgggacag
tttctcacggataagagggcgaacacttttgtggaagtggacatgtacggcttgccagcg
gacactgtgagaaagaagttccgcaccaagacagtccgggacaatggaatgaatccactt
tacgacgaggagccgtttgtgtttaagaaggtggttctgcctgagctggcgagcattcga
atcgccgcatatgaggagggtggcaaactcattggtcaccgcgttttgcccgtaatcggt
ctctgtccgggctaccgacatgtgaatctccgatccgaagtgggtcaaccaatagccctg
gcatcccttttcctgtgcgtggtggtcaaggattatgtgcccgacgatctctccaatttc
gcagaggcgctagcgaaccctattaaataccaaagtgagctggagaagcgcgatattcaa
ctgtctgttctgaccgacgaggccgaagcgctgggcaatgcggacgaggatctgtccaag
tcgttcgttttcgtccaagtaggtggccagaaaaaggagctgcgtccggttgaatcgcta
gcgacttcgcccaagcacagggcgagtatctcggctgctgcggcaatgagtgtggacgtt
accgtggatcggaccgatggcggaaggggagaggatagcgtctccatcgtggcaccctca
attcagcatcagcactccctggaccagtccgtaagcacctccatccgccaggtggagtct
tcgcagtttgatgtggatcttgtgttggcggagccgctggagaagatattggatcacaag
tccgtcaaggaaaagcgtctcgagatggagaagaagctggagtcgctgcgaaagaagcat
gacaaggaaaaggtcaagatcgctggccagaaatccagtccgctggagggcaagaagccg
aagtttgccatcacgaataagctggtgaaacggctaagcaacaagagtcttaattgtctc
tctccgcacagcgagcccggcatagagatccccgcctgccctctggatctaggcgatagc
agcgaggagagcgcagccgcggacgccggcgaggacttagccggcgggagcagcagcctg
gatggcagaacacaggagtcgcgactgcgcagtgcctgccgggagtacacgtcccagtac
cgggagctgcaggagaagtaccacgaagctatttacagtgctgccgagaaggtgctaaag
acatcgcaaactggtcaaacaaagcagctgaaggcatcgctggacaaggtcactggagag
gtgatgcaccagctgcaggaggcgcgccgcaacgaggtcaagaatctggccaccgtgcac
cgggatcgagatgaactgatcagaatgaaacgcgaggtggcaagctccgttgtggaacgt
ggcgtagcagaacgcgtgcggctgaagcagaccttcgaccggcgaacggatgaactccag
aagcagcacgactcagtgcgcaattccctggcagaacaccgctccaaggctcgtcaaatt
ctcgacaaggaggccgaatcgcgaagctgtgtttccagcagtggcttcttggtgctcttc
catggaccgcaccaccacggctgctcgggctccggttcgtcagccctctcaggcaataat
ctcactctaaatctggacgcgggtgctgccggtagtcattcggccatttcgccagcaagg
tcgcacaacagcatcgccgcagcggccgagatgaagacgtaa

DBGET integrated database retrieval system