KEGG   Drosophila yakuba: Dyak_GE16871Help
Entry
Dyak_GE16871      CDS       T01068                                 

Gene name
Dyak_EG:EG0007.7, EG:EG0007.7, dyak_GLEANR_18251
Definition
(RefSeq) GE16871 gene product from transcript GE16871-RA (EC:2.3.1.-)
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE16871 (Dyak_EG:EG0007.7)
Chromosome [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dyak_GE16871 (Dyak_EG:EG0007.7)
   HAT complexes
    TIP60 complex
     Dyak_GE16871 (Dyak_EG:EG0007.7)
    NuA4 complex
     Dyak_GE16871 (Dyak_EG:EG0007.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 541 aa AA seqDB search
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
SGTPAAIPVTPTGASGSVPPPAGIPSSVVPPGTPSSGGELVNGNNLAAALQKRINRKRKV
HGGSAHGHHSLPNQQQQSHPHPTTPQTPTATPVHVTGDGLISGAANEDGDGSQDGKTPTP
RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMSCIYICEFCLKYRKS
RKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYD
TDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYEL
SKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIK
KEDVISTLQNLNLINYYKGQYIVCINRDTIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRS
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaccacaaatatgagttcgacgacgatgtggcctccatttgcgagtcaacg
gccgcccttaccgagggatgtcgcttgcccgtcagaatgcacaaaacggacgattggccg
ctggcggagattgtgagcatcaaagagttggacgggcgccggcagttttacgtgcactat
gtggatttcaacaaacgcttggacgaatgggtcaacgaagaggatctgtacacacgaaaa
gtgcaatttccgcggcgggacggctcccaaacgggcactagcaccggagtgacgacgccc
cagcgccaccattccttagcgggcagcgtttcccggcctacatcgccacaacatcctggt
tccggtactccggcagccatccccgtgactcccactggtgcatcaggcagtgttcctccc
cctgcaggtattcccagctctgtagttcctcccgggacacccagcagtgggggagagctt
gtgaatggcaacaatctggccgcagctcttcaaaagcgcatcaatcgcaaacgaaaagtc
cacggaggctcggcccatggacaccacagcctgccgaatcaacagcagcagtcacatccg
catcctacaactccacagacacccacggctacgcccgtgcatgtgaccggagacggtttg
ataagcggtgcggccaatgaggatggtgatggatcgcaggatggcaagacgcccacgccg
aggcaatcgggcagcatggttacgcaccaggacgacgtggtaacccgcatgaaaaacgtg
gagatgattgaactgggcaggcatcgcattaagccctggtatttctcaccctatccgcaa
gagctgtgtcaaatgtcctgcatctacatttgcgagttctgcctgaagtacagaaagagc
aggaaatgcctggagaggcacctgtctaagtgcaatcttaggcatccgccggggaacgag
atctaccgcaaacacacaatttccttctttgaaatcgacggccgcaaaaataaggtgtat
gcccagaacttgtgcctgcttgccaaactctttctcgaccacaagactctgtactatgat
acagatccgtttctcttctacgtaatgaccgagtttgactcgcgcggcttccacatagta
ggttacttttccaaggagaaggagagtaccgaggattacaacgtggcctgcattctcaca
atgcctccctatcagcgcaagggctacggcaaactgctcattgagttcagctacgagttg
tccaaatttgagggcaagacgggatcgccggagaaaccattgtctgatctgggtttgctg
tcgtatcgatcgtactgggcgcaaaccatactggagatctttatcagccaaaacccgagc
acggacggcgagaagcccaccataacaataaacgacatctgcgaatgcacatccatcaaa
aaagaggatgtgatctcaacgctgcagaacctaaacctgatcaactactacaagggccag
tacatcgtgtgcatcaaccgggataccatcgagcagcaccggcgcgcaatggacaagcgc
aagatccgcatcgactcaaaatgcctgcactggacgccaaaagactggtccaagcgctcc
aaatga

DBGET integrated database retrieval system