KEGG   Drosophila yakuba: Dyak_GE16877Help
Entry
Dyak_GE16877      CDS       T01068                                 

Definition
GE16877 gene product from transcript GE16877-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 631 aa AA seqDB search
MAIPVLKTNGHERLASLDKSMPPASPTLPSPTIRRNKSDGKLMAQDVKEAMVKVIYTGGT
IGMVRNERNALAPIPNALVRSIRKYPNIHDEEYALRRFGTSASMAPLVLPIVQGVDRRVI
YQITEYTPLLDSSNMTMNDWARIASDIQQSYEFFDGFVVLHGTDTLSYTASALSFMLENL
GKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPEVCVFFGHKLMRGNRTVKVSSNA
LDAFDSPNVPPLARIGIDVNVDYRLIFRPCSIERFRVHLNLDENVGLLRIFPSISHSTFR
AFLAPPIRGVVLQSFGSGNIPSNRTDLIDELRAAGERGVIIINCTQCPNGTVAEIYDTGK
VLCDVGVIPGFDMTPEAALSKLAYVIGKEEWSLEVKKQMMQANLRGELTSLKAAKMEDYD
LVDAVARSLHLSSPQELDQLGETLFPAMINAAVAEGDPKKINNLKAYGADLSGTNHDQRT
ALHLACQLGNVEIVKYLLQNGVSVHVRDRYDRTPLLEAVSTDSHEIIQLLINCGAHLTGS
SRAIGEQLCAAAARGSMVRLKSYQFAGADLAQPDPSGRTALHVAALHGFPEVVQYVLPYF
ENPHEKDMLGLTALDYAERGGHAAAIEALKT
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggctattcctgtccttaagaccaatggtcacgagcgcctggcctcgctggacaaaagc
atgccgccggcatcgcccactctgccgagtcccacgatccgcaggaacaaaagtgacgga
aaactaatggcgcaggatgtgaaggaggccatggtgaaggttatctacactggaggcacc
atcggcatggtgcgcaacgagcgaaatgcgctggcacccattcccaatgctctggtgcgc
agtatccggaaatatccgaacatccacgatgaggagtacgcgctgcgccggtttggaaca
tctgcatcgatggctccactggtgctgcccattgttcagggagtagatcgcagggttatc
taccagatcacggagtatacaccgttgctggacagcagcaatatgacgatgaacgattgg
gcgcgaatcgctagcgatattcagcaatcgtacgagttcttcgacggttttgtggtgctc
catggcaccgacacactttcctacacagcatctgcgctatccttcatgttggagaatctg
ggcaagactgtgatcatcacgggctcccaaatccccatctttgagacgcgaaccgatggc
aaggacaattttacgtcggccttgataatagccggtaactacatcattccggaggtgtgc
gtcttcttcgggcacaagctaatgcgcggcaatcggacggtgaaggtcagttcgaatgcc
ttggacgcattcgattcaccaaatgttccaccgctggcaaggatcggcattgatgtgaac
gtggactaccgcctgatattccgaccatgcagtattgaaaggtttcgcgttcacttgaat
ctcgatgagaatgtgggcttgctgcgaatctttccaagcatttcgcattccacattccgg
gcattcctggcgccaccgattcgcggcgtagttctgcaatcgttcggatctggaaatata
ccatcgaaccgaacggacctcatcgatgaactgcgtgcggccggcgaacgaggcgttatc
ataatcaattgcacacagtgtcccaatggcacagtggcggagatctatgatacgggcaaa
gtgctctgcgatgtgggtgtaattcccggtttcgatatgactcccgaggcggccctgtcc
aaactggcctatgtcatcggcaaggaggagtggtcacttgaggtaaagaagcagatgatg
caggcaaacctgaggggcgaactgacctccttaaaggctgccaagatggaggactacgac
ttggtggatgcagtggctcgatctctgcacttgtcctcgcctcaagaactagatcagctg
ggcgaaacgctctttccggccatgatcaacgccgctgtggccgaaggcgatcccaagaag
atcaacaacttgaaagcctatggcgccgacttatcgggaacgaaccatgaccagcgaacg
gccttgcatttggcatgtcagctgggaaacgtggagatcgtaaagtacctactgcagaat
ggagtatccgtgcatgtgcgggatcgctatgatcgcactccgctcctggaggctgtctcc
accgatagccacgagatcatccagctgctcatcaactgtggtgcccatttgacgggatct
tcgcgagcgattggcgaacaactgtgtgcggcagctgctaggggatcgatggttagattg
aagtcctaccaatttgccggtgctgatctcgcccagccggatccttcgggcaggacggca
ttgcacgtggctgctctgcacggatttccagaggtggtgcagtacgtcctgccctacttc
gagaatcctcacgaaaaggacatgctgggcctgaccgccttggattatgcggagcgcggt
ggacacgcggcggctatagaggccctaaaaacatag

DBGET integrated database retrieval system