KEGG   Drosophila yakuba: Dyak_GE17041Help
Entry
Dyak_GE17041      CDS       T01068                                 

Definition
GE17041 gene product from transcript GE17041-RA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dya  Drosophila yakuba
Module
MAPK (p38) signaling
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dyak_GE17041
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dyak_GE17041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 334 aa AA seqDB search
MSKRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDQTFDIDADSLEKICDLGRGAYGIV
EKMRHRQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMSTSLDKFYPKVFRHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGISM
IEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSSEFEDFIAVCLQKEYMARPNYEQ
LLKHSFIVEHLQRNTDISEFVARILDLPDTQPAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgccaccgcctcacgccctttaccattgccaaggagccagaggccgccata
gtcccgccacgcaacctggactcgcgggccaccattcaaattggcgaccagacctttgac
attgatgcagatagtctggagaagatctgcgatctgggccgtggcgcctatggcatcgtg
gagaagatgcgtcatcggcaaaccgatacggtcctggccgtcaaacgcatacccatgacc
gtaaatattcgagaacagcaccgccttgtgatggatttggacatatcgatgagatccagc
gactgcccctacaccgtccacttctatggcgcgatgtatcgcgagggcgatgtttggatt
tgcatggaggtgatgagcaccagcctggacaagttctatccgaaggtcttccgccacgat
ctgcgaatggaggagagcgtgctgggcaagattgcaatgagcgtggtcagtgcgctgcac
tatctgcacgctcagctgaaagtcatccatcgggacgtcaagccctcgaacatactgatc
aatcgggccggccaggtcaagatctgtgactttggcatctcaggctacctcgtggactcc
attgccaaaaccatcgatgccggttgcaagccgtacatggcgccggaacgcatcgatccc
cagggaaatccggcgcaatacgacatcaggtcggatgtttggtcgctgggcatcagcatg
atagaaatggccactggccgctacccgtacgacaattggcgaacgccatttgagcaactg
cgtcaggtggttgaggacagtccgccgcgcctgccagagggaaccttttcgtcggagttc
gaggacttcatcgccgtctgcctgcagaaggagtacatggcgcggcccaactacgagcag
ctgctcaagcacagcttcattgtggagcacctgcagcgcaacacggacatctcggagttt
gtggccaggatactggatctgcccgacacccagccggcgcagtag

DBGET integrated database retrieval system