KEGG   Drosophila yakuba: Dyak_GE17264Help
Entry
Dyak_GE17264      CDS       T01068                                 

Definition
GE17264 gene product from transcript GE17264-RA
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
dya  Drosophila yakuba
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dya00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dya04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1233 aa AA seqDB search
MSCFSAMSAPLLGEMEQTIGMLERGTIVTKLYGKQRRPDRRHLMLIRETRQLLWATVATQ
TPRTDYEGAIQLREIREIRVGKHSKEFRLFADDCQRFESSKCFVILHGNHFKLKSFSVVA
LSEIEADNWVRGLRYMVKDTLGAPYPLQIDRWLRREYYQIENVNSHSAKATEQSPAQVTI
KDFKLFLAGVSCKMTTGKFMEHFTEDVRRKHDLKFDDFSRFYQKLLLPNGFASVLSGSGV
ANFPYSEDQQVVRPSELKQFLETEQRDVSASEISNAAIASFIRDFVQDVERDVQEPYLTI
SEFVDFLFSKQNDLWNSKYDQVFMDMNLPLSSYWIASSHNTYLTGDQFSSESSCEAYARA
LRMGCRCIELDCWNGPDNLPYIFHGHTITSKIKFMDVIKTIKDHAFTSSEYPVILSIEQN
CSLEQQRNMAQALIEVFGDMLLTQPCDRNEQHLPSPYQLRRKIILKHKKLPQFDDITNGI
SGTGSLGHRSSLGGAGGGENDGENVRKVFKEGLLYFKDPVDKSWNLYQFVLTHQELIYSS
EINESRNGNSEDDDFGLSSSCSLNSNMQQKQKDTSANDELHFGENWFHGKLEGGRKEADD
LLKKYKHFGDGTFLVRESATFVGDYSLSFWRRNRPNHCRIKLKHENGSIKYYLVENFVFD
SLYSLIVYYRKNMLRSSEFSIILKEPVPQPKKHEDQEWFHPNTTKEQAEQGLFRLEIGSF
LVRPSVQSINAFVISFTINRKIKHCRIMQEGRLYGIDTMNFESLVSLINYYTRNPLYRNV
KLSHPVSQELLRQALAEAAQGDHSGSHDDNGASNYMGSNLEEHVTCKALYSYKANKPDEL
SFPKHAIITNVQRDNSMWWIGDYGGMIKKHLPANYVKVIDSTTEDYNSLNEEGTDGRTDS
IEIFGAVASLFESNDPGIIFKLQIQTPTMQNPFVIGFDNQETAYEWIKAIQEAALIASQL
ASERRKKERTARVAKEMSDLIIYFRSVPFREHSWIFQEMSSFPETKAEKQFFQQNTQLFL
SYHRNQISRVYPKGQRLDSSNFNPMPFWNIGSQMIALNYQTGDKAMQLNQAKFRNNGQCG
YILKPSFMKSDSFNPNNPLCDGLSEVKVSIRLIAARHLFRGGKSNNPQIVVEIVGASYDT
GVKYRTKVNENGFNPVWNESCEFNVRNPQFAILRFEVQDEDMFAETHFIAQACYPLTCIR
QGYRSVILRNKFSEELELSSLLINIKVANATSP
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgagctgctttagtgcgatgagtgccccgctgctgggcgagatggagcaaaccattggg
atgctggagcgcggcaccattgtgaccaagttgtatgggaaacagcgtcgtccagatcgt
cgacacctgatgctcatccgagagacccgacagctgctgtgggccacggtggccacccaa
acgccacgcaccgactacgagggtgccatacagctgcgtgagattcgcgagatacgggtg
ggcaagcactccaaggagttccgcctgtttgccgacgactgccagcgcttcgagtccagc
aaatgctttgtcattctgcacggcaatcacttcaagctgaagagcttctctgtggtggct
ctgtcggagatcgaagccgataactgggtgcggggattgcgttacatggttaaggacact
ctgggagcaccctatcccttgcaaattgaccgctggctgcgtcgcgagtactaccaaatc
gagaatgtgaactcgcattctgccaaggccacggaacagtcgccagcccaggtgactatc
aaggactttaagctctttttggccggagttagctgtaagatgaccaccggcaagttcatg
gagcactttaccgaggatgtgaggcgcaagcacgatctcaagtttgacgacttctcgcgg
ttctatcagaagttgctgctgcctaacggatttgccagcgtcttgtcgggatcgggagtg
gccaactttccctattcggaggaccaacaggtggtgcgaccgtctgagctaaagcagttc
ctggagacggaacaacgcgatgtgagcgccagtgagatcagtaacgcagccattgcctcc
ttcattcgggactttgttcaggatgtggaacgggacgtccaggaaccgtatctcaccatt
tccgagtttgttgactttctcttctcgaagcagaacgacctgtggaacagcaaatacgac
caagtgttcatggacatgaacttgccgttgtcctcctactggatcgcatcgtcgcacaat
acctacctgacgggggatcagttctctagcgaatcctcctgcgaggcctacgcccgcgcc
cttcgcatgggatgccgctgcatcgagctagactgctggaatgggcccgacaacctgccc
tacatatttcacggccacaccatcacctccaagatcaagttcatggacgtcatcaagacg
atcaaggaccacgccttcaccagctccgagtatccggtgatactgtccatagagcagaac
tgctccctggagcagcagcggaatatggcgcaggccttgatcgaggttttcggcgatatg
cttcttacgcaaccttgtgaccggaacgagcagcacttgccatcgccgtaccagttgcgt
cgcaagataatcctgaagcacaagaagttgccgcagtttgacgacatcaccaatgggatt
tctggcacgggttcactgggccatagatcttcgctgggaggagcgggcggtggggagaac
gatggcgagaatgtgcgcaaggtgttcaaggagggattgctgtacttcaaggatccggtc
gataagtcctggaatctgtaccagttcgttctgacccatcaggagctgatctactcctct
gaaatcaacgagtcgcgcaatggaaactctgaggatgacgactttgggctttcttcgtcg
tgttccctaaacagcaacatgcagcaaaagcagaaggatacctcggccaacgatgagctg
cacttcggcgagaattggttccatggcaaactggaaggtggcaggaaggaggcggatgat
ttgctgaagaagtataaacattttggcgatggaacttttttagttcgagaatcggccacg
tttgtgggtgactatagtctctcgttttggcgacgaaatcgcccgaatcactgccgcatt
aagttaaagcatgaaaatggatcaatcaaatactatctagtggagaattttgtgttcgat
tcactgtactcactgatcgtttactaccgcaagaatatgctgcgtagctcagagttttcg
attatactaaaggagcctgttccgcagccgaaaaagcacgaggatcaggagtggttccat
ccaaacaccacaaaggagcaggccgaacagggactgtttaggctggaaatcggttcgttt
ctggtgcggccatcggtgcagagcattaacgctttcgtcatttcgtttacaatcaatcgg
aagatcaagcactgccgaattatgcaggagggacgtttgtacggcatcgatacgatgaat
ttcgagtctctggtctcgctgatcaactactatacccgaaacccactctatcgcaatgtt
aagctcagccatccggtctctcaggagctgctgcgtcaggcgctagcggaggccgcccag
ggcgatcacagtggcagccacgacgacaacggtgcctccaactacatgggctccaactta
gaagagcacgtcacctgcaaggcgctctacagctacaaggcgaacaagccagatgagctc
tcgtttcccaagcacgccatcataacgaatgtgcagagggacaactcgatgtggtggatt
ggggattacggtggcatgataaagaagcacctgccggcaaactacgttaaggttatcgat
tcgaccacggaggactacaactcgttgaacgaagagggtacagatggacgcaccgactcc
attgagattttcggagctgttgcctcgctcttcgagtccaacgatccgggcattatcttc
aagctgcagatacaaacgccaacgatgcagaatccgtttgtgattggcttcgacaaccag
gagacggcgtacgagtggataaaggcaatccaggaggcagccctcatcgccagtcaactg
gcatcggagagacggaaaaaggagcgcactgcccgtgtggccaaggagatgtccgacctg
atcatctacttccgcagtgtgccgttccgcgaacactcgtggatatttcaggaaatgtca
agtttcccagaaacaaaggcggagaagcagttcttccagcagaacacacaactgtttctc
tcctaccatcgcaatcagattagcagagtgtacccgaagggtcagcgcttggactcgtca
aactttaaccccatgccattctggaatataggatcacagatgatcgcactgaactatcag
acaggcgataaggccatgcagcttaatcaggccaagttccgaaacaatgggcaatgtggc
tatatcctaaagccgtcgttcatgaagtcagatagcttcaatccgaacaatccgctgtgc
gatggcctaagcgaagtgaaagttagcatacggctgatagccgcacgtcatctatttcgg
ggcggcaaatcgaacaatccgcagatcgtggtcgaaatagttggcgctagctatgataca
ggcgttaagtaccgcaccaaagtcaacgaaaatggtttcaatccggtgtggaatgaatcg
tgcgagtttaacgtgcgcaacccacaattcgcgattcttcgcttcgaagtgcaggacgag
gatatgttcgccgagacgcacttcatcgcccaggcgtgctatccgctgacctgtattcgc
caaggttatcgcagcgtcatcctacgaaataagttcagcgaagagctggaactatcgtcc
ctgctgattaacatcaaggttgcaaatgccacttccccgtag

DBGET integrated database retrieval system