KEGG   Drosophila yakuba: Dyak_GE17287Help
Entry
Dyak_GE17287      CDS       T01068                                 

Definition
GE17287 gene product from transcript GE17287-RA
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
dya  Drosophila yakuba
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dya00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dya00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 2184 aa AA seqDB search
MVGYTEALTDRSYSGQILVLTYPLIGNYGVPAPDEDEHGLPLHFEWMKGVVQATALVVGE
VDDEASHWRKWKTLPQWLQQHKVPGIKDIDTRALTKKLREQGSMLGKIVYEKPPVEGLPK
SSFEDPNVRNLAQECSVKERHVYGDPNGKGPRIAILDCGLKLNQLRCLLQRGASVTLLPW
SARLEDEQFDALFLSNGPGNPESCDQIVQQVRKVIEEGRKPVFGICLGHQLLAKAIGCST
YKMKYGNRGHNLPCLHRATGRCLMTSQNHGYAVDLEQLPDGWSELFVNANDGTNEGIVHA
SKPYFSVQFHPEHHAGPQDTEFLFDVFLESIKQKDLTILQLIEQRLRPTRISKEPAPVKP
RKVLILGSGGLSIGQAGEFDYSGSQAIKAMRESNIQTVLINPNIATVQTSKGMADKCYFL
PLTPHYVEQVIKSERPNGVLLTFGGQTALNCGVELERAGVFSKYNVRILGTPIQSIIETE
DRKLFAERVNEIGEQVAPSEAVYSVAEALDAASRLGYPVMARAAFSLGGLGSGFANNEQE
LQILAQQALAHSSQLIVDKSLKGWKEVEYEVVRDAYDNCITVCNMENFDPLGIHTGESIV
VAPSQTLSDREYQMLRSTALKVIRHFGVVGECNIQYALCPHSEQYYIIEVNARLSRSSAL
ASKATGYPLAYVAAKLALGMPLPDIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFVRVS
KHIGSSMKSVGEVMAIGRNFEEAFQKALRMVDSDVLGFDPDVVPLDAGRTQLVEQLSEPT
DRRPFVIAAALKLGMTISELHQLTNIDCWFLAKLKRIIDLQFELTKAGSRIDAPLLLKAK
RFGFSDKQIAKAIKSTELAVRHQRQEFGIRPHVKQIDTVAGEWPASTNYLYNTYNGSEHD
VDFPGGHTIVVGSGVYRIGSSVEFDWCAVGCLRELRKLQRPTIMINYNPETVSTDYDMCD
RLYFEEISFEVVMDIYEMENSEGIILSMGGQLPNNIAMDLHRQQAKVLGTSPESIDCAEN
RFKFSRMLDRKGILQPRWKELTNLQSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDL
ETYLNAASEVSREHPVVISKFLTEAKEIDVDAVAADGRILCMAVSEHVENAGVHSGDATL
VTPPQDLNAETLEAIKRITCDLASVLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVS
KTLDHDFVATATRAIVGLDVEPLDVLHGVGKVGVKVPQFSFSRLAGADVQLGVEMASTGE
VACFGDNRYEAYLKAMMSTGFQIPKNAVLLSIGSFKHKMELLPSIRDLAKMGYKLYASMG
TGDFYAEHGVDVESVQWTFDKTTPDDINGELRHLAEFLANKQFDLVINLPMSGGGARRVS
SFMTHGYRTRRLAVDYSIPLVTDVKCTKLLVESMRMNGGKPPMKTHTDCMTSRRIVKLPG
FIDVHVHLREPGATHKEDFASGTAAALAGGVTLVCAMPNTNPSIVDRETFNQFQELAKAG
ARCDYALYVGASDGNWAQVNELASQACGLKMYLNDTFGTLKLSDMTSWQRHLSHWPKRAP
IVCHAEKQSTAAVIMLAHLLDRSVHICHVARKEEIQLIRAAKEKGIKVTCEVCPHHLFLS
TKDVERLGHGMSEVRPLLCSPEDQEALWENIDYIDVFATDHAPHTLAEKRSERPPPGFPG
VETILPLLLQAVHEGRLTLEDIKRKFHRNPRIIFNLPEQAHTYVEVDLDEEWTITGSEMK
SKSGWTPFEGTKVKGRVHRVVLRGEVAFIDGQVLVQPGFGQNVRAKQGQLTSEASQDLLP
SDSDANDTFARLLTTGGAAGAAVHGTSTKVHFVDGANYLRPTSPAPRVRLDSASNTTLRE
YLQRTSSPNPVAHSLVGKHILAVDMFNKEHLNDIFNLAQLLKLRVTKDRPVDELLRGKIM
ASVFYEVSTRTQCSFAAAMLRLGGRVISMDQITSSVKKGESLEDSIKVMASYADVMVLRH
PTPGAVARAATFSRKPLINAGDGVGEHPTQALLDIFTIREEFGTVNGLTITMVGDLKNGR
TVHSLARLLTLYNVTLQYVAPPSLQMPNEVVQFVHQRGIKQFFASGLKDVLPDTDVIYMT
RIQRERFENVADYENCCGHLLLTPELMTLAKKRSIVLHPLPRLDEISRDIDSDPRAAYFR
QAEYGMYIRMALLAMVVGGRNTAL
NT seq 6555 nt NT seq  +upstreamnt  +downstreamnt
atggtcggctacacggaggcgcttacggatcgatcgtacagtggtcagatcctggtgctc
acgtacccactgatcggtaactatggggtgccggctccggatgaggacgagcacggactg
ccgctgcactttgagtggatgaagggcgttgtccaggccaccgccttggtggtgggcgag
gtggatgatgaggcatcgcactggcgcaaatggaagaccctgccccaatggctgcagcag
cacaaggttcccggtattaaagacatcgatacccgagccctgaccaaaaagctgagggag
cagggaagcatgttgggcaagattgtctacgagaaaccgccggtcgagggactgcctaag
tccagtttcgaggatccgaacgtcaggaatttggcccaggagtgcagcgttaaggagcga
catgtgtacggggatcccaatggcaagggaccccggatcgccattctggactgcggactg
aagctcaaccagctgcgctgcttgctgcaacgtggcgcctcggtgaccttgctcccctgg
agcgctcgtctcgaggatgagcagttcgacgccctcttcctgtccaacggacctggcaat
ccggagagctgcgaccagatcgtccaacaggtgcgaaaagtgattgaggagggtcgaaag
cccgtctttggcatctgcctgggtcaccaactgctggcgaaggccatcggctgctccacg
tacaagatgaagtacggcaatcgaggccacaatctgccctgcttgcaccgagcaactgga
cgctgtctgatgacgtcgcagaatcacggatacgcggtcgatttggagcagttgcccgac
ggctggtcggagctgtttgtgaatgccaacgacggcaccaacgagggcattgtccatgcc
agcaagccctacttttcggttcagttccatccggagcatcatgctggaccgcaggacacg
gagttcctatttgatgtttttctggagagcattaaacagaaggacctgaccatcctgcag
ctgatcgagcagcgattgcgtccgactaggatttccaaagaaccggctccggtgaagccg
cgcaaagtccttatcctgggatccggtggactgtccattggtcaggctggcgagtttgac
tactccggctcgcaggccatcaaagcgatgagggaatcaaacattcagaccgtgctcatc
aatccgaacatagccaccgtacagacctccaagggaatggccgacaagtgctacttcctg
cccttgacaccacactatgtggagcaggtgatcaagtcggagcgtccgaacggagtactc
ctcaccttcggcggccaaaccgccctcaattgtggcgtggaactggagcgagccggagtg
ttctccaagtacaatgtccgcattctgggcacacccatccagtcgatcatcgagacggag
gacaggaagctttttgccgagcgggtgaacgagattggcgagcaggtggcgccatctgag
gcagtatactccgttgcagaggcacttgatgcggccagtcgcttgggttatccggtgatg
gcccgtgctgccttctctctcggcggactgggttccggattcgccaacaacgagcaggag
ctgcagatcctggcccaacaggcactggcccactcgagtcagctaatcgtggacaaatcc
ctgaagggatggaaggaagtagagtacgaggtggtgcgcgatgcctacgacaactgcatt
accgtttgcaacatggagaacttcgatcccctgggcattcacacgggcgagagtatagtg
gtggccccgtcgcagaccctctcggatcgcgagtaccaaatgctccgtagcaccgccctg
aaggtgatccgtcactttggcgtcgttggcgagtgcaacatccagtacgccttgtgtccc
cattcggagcagtactacatcatcgaggtgaatgcccgactgtcgcgcagctccgcgttg
gccagcaaggccaccggctatcctctggcctatgtggccgccaagttggctttgggaatg
cccctgccagatatcaagaactcggtgacgggcaatacgacggcctgctttgagccatcc
ctggattactgtgtggtcaagattccacgctgggatctggcgaaattcgtgcgagttagc
aagcacattggcagctccatgaaaagcgtcggtgaggtgatggccatcggccgcaacttc
gaggaagcgtttcagaaagccctgcgcatggtggacagcgatgtgcttggctttgatccg
gatgtggtgccgcttgacgctggtcggacgcagctggtcgagcagctttcggagccgact
gatcgtcgtcccttcgtcatcgccgctgctctgaagttgggcatgacgatctctgaactg
catcaactaaccaatatcgattgctggttcctcgccaaactgaagaggatcatcgatctt
cagttcgaactcaccaaggctggcagtcgaatcgatgccccactgctgctgaaggcaaag
cgttttggtttttcggacaagcagatagccaaggccatcaagagcacggagctcgctgtt
cgccaccagcggcaggagtttggcatccgtccgcatgtcaagcagatcgacacggtggcc
ggcgaatggcccgccagtaccaactatctgtacaacacgtataacggaagcgagcacgat
gtggacttccccggcggtcacaccattgtggtgggctcgggcgtctaccgaatcggatcc
tccgtggagttcgattggtgtgccgtgggctgtctgcgcgaactgaggaagctccagcga
cccaccatcatgattaattacaacccggaaacggtgtccaccgactacgatatgtgcgat
cgcttgtacttcgaggagattagcttcgaggtggtcatggacatctacgagatggagaat
agcgaaggcatcattctgtccatgggcggccagctgcccaacaacatagccatggatctg
catcgccagcaggccaaggtgttgggtacatcgccggagtccatcgattgtgccgaaaat
cgattcaagttctcccgcatgctggacaggaagggcattctgcagccgcgctggaaggag
ctgaccaacctacagtcggccatcgaattttgcgaggaggttggctatccctgtctggtt
aggccatcctatgtgctctccggcgcggccatgaatgtggcctattccaatcaggatctg
gagacgtacctgaacgccgcatcggaggtgagccgcgagcatccggttgtcatctccaag
ttcctcaccgaggccaaggagatcgatgtggatgcagtcgccgccgatggacgcatcctg
tgcatggctgtttcggagcacgtggagaatgccggtgtgcattctggtgatgccacgctg
gtcactccaccgcaggatctgaatgcggagaccttggaggccatcaagcggatcacttgc
gatctggccagcgtactggatgtcaccggccccttcaacatgcagctgattgccaagaac
aacgagctgaaggttatcgaatgcaatgtccgggtgtcacgatccttccccttcgtctcc
aagacgctggaccatgactttgtggccacggcgacgcgagccattgtgggactcgatgtg
gagccgctggacgtgctccatggtgtcggcaaggtgggcgtcaaggtgccacagttcagc
ttctcgcgtctcgcgggcgcagatgttcagctgggcgtcgagatggcctccaccggcgag
gtggcctgcttcggggacaatcgctatgaggcgtatctcaaggccatgatgtccaccggc
ttccagatacccaagaacgccgtgctcctctccattggcagtttcaagcacaaaatggag
ctgctgccttctattcgagatctggccaagatgggctacaagctatacgcttccatgggc
actggcgacttttatgcggaacacggagttgatgtggaatccgtgcagtggacattcgac
aagacgacacccgacgacatcaacggggagctgaggcacctggccgagttcctggccaac
aagcagttcgacctggtcatcaaccttccgatgagcggcggaggcgccaggcgggtctcc
tcgttcatgacccatggctaccgcacccgtcgcctggccgtggactactccattccgctg
gttaccgatgtgaagtgcaccaagctgctggtggaatcgatgcgcatgaacggcggcaaa
ccgccaatgaaaacgcacacggattgcatgacctcgcggaggattgtgaagctgccgggt
ttcatcgatgtgcatgtgcatttgcgggagccgggagccacgcacaaggaggacttcgcc
agtggaacagccgccgccttggccggcggagtgaccctcgtgtgcgccatgcccaacacg
aatccctcgatcgtggacagagagacgttcaaccagttccaggagctggccaaagcggga
gcacggtgcgactatgcgctgtatgtgggcgcctccgatgggaactgggcgcaggtcaac
gagctggccagtcaggcgtgtggcctgaaaatgtacctgaacgacacgttcggtaccctg
aagctgagcgacatgaccagctggcagaggcatctcagccactggcccaaacgggcgccc
atcgtttgccatgcggagaagcagagcacagcggctgtgatcatgctggcccatctgctg
gaccgttccgttcatatctgccatgtggcgcgtaaggaggagatccagttgatccgtgcc
gccaaggagaagggcatcaaggtgacgtgcgaggtgtgcccccatcatttgttcctcagc
acgaaggatgtagagcgtttgggtcacggaatgtccgaggtaaggccattgctctgctcg
ccggaggatcaggaggcattgtgggagaatattgattacatcgatgtgtttgccaccgat
catgcgccacacacgctggccgagaaacgttcggagcgtccgccgccgggatttccgggc
gtggagaccattttgccgcttctcctgcaggccgtgcacgagggtcgcttgacactggag
gacatcaagaggaagttccatcgcaatccgagaatcatcttcaatctgcccgaacaggcg
cacacctatgtggaggtggatctggacgaggagtggaccataacgggcagcgagatgaag
agcaagtccggctggacgccattcgagggcaccaaggtcaagggacgtgtccaccgcgtc
gttctccgcggcgaggttgccttcatcgatggccaagtgctggtgcagcccggcttcggc
cagaacgtgcgtgccaagcaggggcaactcacgtcggaggcatcgcaggatctgctgccc
agcgacagcgatgccaatgacacctttgcccgcctccttaccaccggcggagcagccggt
gcagccgtacatggcacatcgacaaaggtgcactttgtggatggagccaactacctgcgc
cccacctcgccagcgccacgcgtccgtctggattccgccagcaacaccacgctgcgggag
tacttgcagcgcacttccagcccaaatccggtggcccactcgctggtgggcaagcacatc
cttgccgtggacatgttcaacaaagagcacctcaacgacatctttaatctggcacaactg
ctcaagttgcgggtgacaaaggatcgtccggtggacgagctgctgcgcggcaagatcatg
gccagtgtgttctacgaggtcagcacgcggacgcagtgcagctttgcagctgccatgctg
cgtttgggtggccgagtgatcagcatggaccagatcacgtcgtcggtgaagaagggcgag
agcctggaggacagcatcaaggtgatggccagctacgcagacgtcatggtgctgcgtcat
cccacgcccggtgctgtagcgcgcgcagcaaccttctcccgcaagccgctaatcaatgcc
ggcgatggcgtcggcgagcatcccacgcaggcgctgctggacatcttcaccattcgcgag
gagttcggcacggtgaacgggctgaccatcaccatggtgggtgatctgaagaacggacgc
accgtgcactcgctggcccgcctgctgaccctgtacaatgtgaccctgcagtatgtggcg
ccgcccagcctgcagatgcccaacgaggtcgtccagtttgtccaccagcgcggcatcaag
cagttctttgccagcggccttaaagacgtgcttcccgacacggatgtgatctacatgacg
cgcattcaacgcgagcgtttcgagaacgtggcggattacgagaattgctgtggccatctg
ctgctgacgcccgagctgatgacgctggccaagaagcgctcgattgtgctgcatccactg
ccgcgtctggacgagatcagccgcgacatcgactcggacccgagggccgcctacttccgg
caggcggagtacggcatgtacatccgcatggcattgctggccatggtcgttggtggacgc
aacacagcgctctag

DBGET integrated database retrieval system