KEGG   Drosophila yakuba: Dyak_GE17301Help
Entry
Dyak_GE17301      CDS       T01068                                 

Definition
GE17301 gene product from transcript GE17301-RA
Orthology
K04447  
Janus kinase 2 [EC:2.7.10.2]
Organism
dya  Drosophila yakuba
Pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dya04630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 1226 aa AA seqDB search
MELPLQFGASLQLRCCSRAASGNCSSRKLGLQEEHKAPSPEAPLADDPLMALANGGEDKM
DDSSSGRTSLADSASLTNSSLRSGTSSQSIHTNDGTIRVFNFTTSEFERFHPNMLCEEIC
NTMCRQLGIAPIAQLLYGIREHSTSRRPSPLVRLDLTWCLPGERLNCHLVYCFRMRFRVP
ELDSQLELIDGRSHKFLYRQMRYDMRTEQIPEIRYPEHKDKSTGLAVMDMLIDDQEQTED
QHAMRSIEKLYKLYLPPSLWRAHSFFVGSKIREVFRNLKANSPSVERLKWHYVHQVSHLA
PTYMTEQFTCTVQYLPNEEVARGSGPIGTSLAHSTSTLASSGSTNTLSTLTTNTNSVALG
GSGKKSKRRSASGVIDVYVRVFPHDSLEPGLKVARVTSEATLKWILVGAVEGIFMISKIN
DTSVRLEIVGLPKGYEMQFQTEKEMKSFISYLGIYIRLSSKWMQDLCHSYRTPSLEELSS
LHCHGPIGGAYSLMKLHENGDKCGSYIVRECDREYNIYYIDINTKIMAKKTDQERCKTET
FRIVRKDSQWKLSYNNGEHVLNSLHEVAHIIQADSPDRYRIPASKYDKPPLLLLLLPKNL
KAKKTDLQLSEAELQRRNPQIFNPKTDLQWYPDSISLSDDGMMFTMRGDWIQQSPVKDVS
VTMKMLKSDGNFMEFFRLAQTWSLIQSPQFLKLYGLTLADPYTMVMEYSRYGPLNKFLHS
TPNVTLHCLLDLMHGLVRGMHYLEDNKIIHNYIRCSNLYVTKYDPNSYVLDAKISDPGYP
RPFQESDSPWIPVKYYRNLQAAKTDQFAQLWAFATTIYEIFSRCKEDLSSLRQEQLIRQK
NLDGNILKMLDQDLCPAPIFETIMDGWSDDETKRFSHHDIFSRLNTIKSEILPTYMPPPE
IATNGTGDEEVFDISDLPFLPFPRSNMLMVIPLTSECRVIYNMENMIGRGHYGTVYKGHL
EFNDKDQPREQVAIKMLNTMQVSTDFHREIGIMRTLSHPNIVKFKYWAEKSHCIIMEYLQ
SGSFDIYLRFTAPNLNNPRLVGFALDIANGMKYLSDMGLIHRDLAARNILVDHNGDGDCV
KISDFGLAQFANSDGYYFAKSKRDIPIKWYSPEAISTCRFSSYSDVWSYGVTLFEMFSRG
EEPNLVPIQTSQEDFLNRLQSGERLNRPANCPDFIYDLMQLCWHATPRSRPNFATIVDII
TKEIATKVSHPTDGHQLPPNQPADAE
NT seq 3681 nt NT seq  +upstreamnt  +downstreamnt
atggaactcccgctgcagttcggggcatccttgcaactgcggtgctgcagtagggccgca
agtggaaactgctccagccgaaaactgggcttgcaggaggagcacaaagcgcccagccca
gaggcaccactcgccgacgatcctctcatggccctggccaacgggggagaggataaaatg
gacgacagcagcagcggacgcacctcgctggcggatagcgccagcctgacgaactcctcc
ttgcgcagcggcacctcctcacagagcatccacaccaacgatggcacaatccgtgtgttc
aacttcaccaccagcgagtttgagcgcttccatcccaacatgctgtgcgaggagatctgc
aatacaatgtgccgccagttgggcattgccccaattgcccagctgctctacgggataagg
gagcactccacatcgcgacgtccgtcgccgctggtgcgtttggatctgacgtggtgcctg
cccggcgaacgactcaactgccaccttgtctactgctttcgtatgcggttccgggtgccc
gaattggacagccagctggagctgatcgacggacggagtcacaagttcctttaccgccag
atgcgctatgatatgcgaactgagcaaatcccggagattcgatatccggagcacaaggac
aagtcaacgggactggcggtgatggacatgctgatcgacgatcaggaacagacagaggat
cagcatgcgatgcgctccatcgagaagctttacaaactgtatttgccaccgagcttgtgg
cgcgcccacagcttctttgtgggctccaagatacgcgaggtgttccgcaatctgaaggcg
aattcgccgagtgtggagcgcctgaagtggcactatgtgcaccaggtctcccacctggcg
cccacctatatgaccgaacagtttacctgcaccgttcagtatctgcccaacgaggaggtt
gcccgcggcagcggacccatcggcaccagtctggcccactccacatcgacgctggccagt
tccggttccaccaacaccctgtccacgctcaccaccaacaccaattccgttgcactcggc
ggcagtggcaagaagtcgaaacgacgatccgccagcggggtaatcgatgtctatgtgcga
gtctttccacacgactccctggagccgggactcaaggtggccagggtgacctccgaggcc
acactcaagtggatcctcgttggagctgtggagggaatttttatgatctccaaaattaac
gacacctcggtgcggctggaaatcgtgggtctgcccaagggctacgagatgcagttccag
acggagaaggagatgaagtccttcatctcctacctgggcatctacatcagattgtccagc
aaatggatgcaggacctgtgccactcgtaccgcacgccctccctggaggagctgagctcc
ctccactgccatggcccgatcggcggtgcctactcgctgatgaagctgcacgagaacggg
gacaagtgcggcagctacattgtgcgcgagtgcgaccgggaatacaacatatactacatt
gatatcaacaccaaaatcatggccaagaaaaccgatcaggagcgctgcaagacggagaca
tttaggatcgtgcgcaaggactcgcagtggaagctaagctacaacaacggcgagcatgtg
ctgaactcgctgcacgaagtggcgcacatcatccaagcggacagtcccgatcggtatcgc
atacccgcctccaagtacgacaagccgccgctgctgctcctgctgctgccaaagaacctc
aaggccaaaaagactgacctgcaactcagcgaggcggagctgcagcgccgcaatccgcag
atcttcaatcccaagacggatctgcagtggtatccagattcgatttcgcttagcgacgat
ggcatgatgtttacgatgcgcggcgattggatccaacagagtcccgtgaaggatgtctcc
gtgacaatgaagatgctgaagagcgacggcaatttcatggagttctttcgtctggcgcaa
acctggagcctcatccaatcgccgcagttcctcaagctgtacggcctaacgcttgccgat
ccctacacgatggtcatggagtattcgcgctacggcccgcttaacaagttcctgcattcg
acgcccaatgtcacactgcattgtctgctggacctgatgcacggattggtgcgcggcatg
cactatttggaggacaataagatcatccacaactacatacgttgcagcaatctgtacgtg
accaaatacgatccaaattcgtacgtgctggacgcaaaaatcagcgatcccggctatccg
cgtcccttccaagaatccgactcgccatggatacctgttaagtattatcgcaatttgcag
gcggccaaaacggatcagtttgcacagctgtgggcctttgctaccaccatatacgagatc
ttctcgcgctgcaaagaagatctgagtagcctgcgccaggagcagctaatcaggcagaaa
aatctcgatggcaacatactcaagatgctcgaccaggacctgtgtcctgcgccgatcttt
gaaacaatcatggatgggtggtccgatgatgagaccaagcgattcagtcaccacgacatt
ttctcccgcctcaacacgatcaagtcggaaatactgcccacttatatgccgccacccgaa
atcgcaacgaatggaactggggacgaggaagtgtttgatataagcgacttaccgttcctg
cccttcccgcgttcgaatatgttgatggtaataccgctgaccagcgagtgccgtgtgatc
tacaacatggagaacatgattgggcgcggtcactatggcactgtgtacaagggtcatctg
gagttcaacgacaaggatcagccgcgggagcaggtggccatcaagatgctgaacaccatg
caggtgtcgaccgactttcaccgcgagatcggcatcatgcgaacgctaagtcaccccaac
atagtcaagtttaagtattgggcagagaagtcacactgcatcatcatggagtacttgcaa
tccggttccttcgacatctacctgcgcttcacggcacccaatctcaataatcctcgcctc
gtcggtttcgccttagacattgccaatggcatgaaatacttgtccgacatgggactgatc
cacagggacttggccgcccgcaacattttggtggatcacaacggcgatggcgactgcgtc
aaaatctcagacttcggcctggcgcagttcgccaattccgatggatattactttgcgaaa
agcaagcgtgatattcccattaaatggtactctccggaggccatctccacctgcagattc
tcatcgtattcggacgtttggagctatggcgtaacactgttcgaaatgttctcccgcggc
gaggagcccaacctggtgccgattcagacgtcgcaggaggacttcctcaaccgcctccaa
agcggcgaacgcttaaatcgaccagccaattgtccagacttcatttacgacctgatgcag
ctgtgctggcacgccacgcctcgttcgcgtcccaatttcgccaccatcgtggacatcatc
acaaaggaaatagccaccaaggtgtcgcacccgaccgatggccaccagttgccgccgaat
cagccggcggatgccgagtga

DBGET integrated database retrieval system