KEGG   Drosophila yakuba: Dyak_GE17428Help
Entry
Dyak_GE17428      CDS       T01068                                 

Definition
GE17428 gene product from transcript GE17428-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dya  Drosophila yakuba
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE17428
Enzymes [BR:dya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dyak_GE17428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 277 aa AA seqDB search
MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLEELRAKLQNPDKYAG
IIFTSPRCVEAVAESLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARA
LGEYIVDTFDGSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVER
ALEIYGDSIEFLAFFSPSGVNCAQQYFTSRQLSMDKWKLVAIGPSTRRALESLGLKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERMAALENNI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcgccagcgaactgtgattatattcaaatcggagtcggaaagcagcgatgtg
tacgcggaaacgctggagaagcacgatttcaatccggtgtttgtgcccacgctgagtttt
ggcttcaagaatctggaggagctgcgcgccaagctccagaatccggacaaatatgccggc
atcattttcacatcgccgcgctgcgtggaggctgtggctgaatccctgaatctgggcgag
ctgcccggcggttggaagatgttgcataactatgccgtcggcgaggtgacccacaatctg
gcgctgagcaccttggaccagctattcacccacggcaaacagacgggcaatgcccgggca
ctgggcgaatatattgtggacacgttcgatggatcgcgggcactgccgctgctactgccg
tgcggcaatctggccaccgatacgctgctctccaagctggccgagaatggcttctctgtg
gatgcctgcgaggtgtacgagacgcgctgccatcccgaattgggcgcaaatgtggagcgg
gcactggagatctatggcgactcgatcgaattccttgccttcttctcgccatcgggcgtc
aattgtgcgcagcagtacttcaccagccgccagctgtcgatggacaagtggaaactggtg
gccatcggcccgagcaccaggcgtgccctcgaatcgctgggcctgaaggtctactgcacc
gccgagcggccgacggtggagcacctggtcaaggtgctgctcaatccgcaggacagccgg
gagcgactactcaaggagcgcgagcggatggccgccctcgagaataacatttaa

DBGET integrated database retrieval system