KEGG   Drosophila yakuba: Dyak_GE17436Help
Entry
Dyak_GE17436      CDS       T01068                                 

Gene name
dyak_GLEANR_18766
Definition
(RefSeq) GE17436 gene product from transcript GE17436-RA (EC:3.1.2.22)
  KO
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dya  Drosophila yakuba
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dyak_GE17436 (dyak_GLEANR_18766)
  Lipid metabolism
   00062 Fatty acid elongation
    Dyak_GE17436 (dyak_GLEANR_18766)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE17436 (dyak_GLEANR_18766)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dyak_GE17436 (dyak_GLEANR_18766)
Lipid biosynthesis proteins [BR:dya01004]
 Fatty acid synthase
  Component type
   Dyak_GE17436 (dyak_GLEANR_18766)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 315 aa AA seqDB search
MICLFPSSRIVCLLCWLFLILALVLGYIWWKPTKGGTNADVLPVVLWHGMGDTCCVPFSL
GSIMSLIVEQTKGGYVRSLEIGGNVVLDWESGFFIHPNEQVEYVCQQLQLDERLAKGYNA
IGFSQGGQFLRAVAQRCPNPPMRTLITLGGQHQGIFGLPMCPTLTIRSCDYITRLLDDAA
YTPEVQSKLVQATYWHDPIMENKYRLGSTFLADINNELIINEFYIENLRKLKKFVMVQFL
NDTIVQPKESQWFQYYTSGQNKVIQPFTESKVYEDLGLNKMHRQGKLVFLGVEGDHLAIS
KAWFIQNIVPLLLEK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtttgtttccttctagtcgtatagtatgtcttttatgttggctgtttctgatc
ctggccctcgtccttggctacatctggtggaagccaacgaaaggaggaaccaatgcagac
gtcctgccggtcgttctctggcacggaatgggcgacacctgctgcgtgcccttcagcctg
ggttccattatgagcctgattgtggagcagacaaagggcggctatgtgcgatccctggag
atcggcggcaatgttgtgctggactgggagagcggcttcttcatacatcccaacgagcag
gtggaatacgtttgccaacaactgcagctggatgagcgcctggccaagggatacaacgca
atcggattctcgcagggcggccagttcctgcgcgcggtggcccaacgatgtccgaatccg
ccgatgagaaccctcatcaccctcggcgggcagcaccagggcatcttcgggctgcccatg
tgccccaccctgaccatacgctcctgtgactacataaccaggctgctggacgatgccgcc
tacacacctgaagtccagagtaagttggttcaggccacctactggcacgatccgatcatg
gagaacaaataccgcctgggcagcacatttctggcggacattaacaatgagctcatcatc
aacgagttctacattgagaacctacgcaagctgaagaaatttgtgatggtgcagttcctg
aacgacacgattgtgcagccgaaggaatcccagtggtttcaatactacaccagcgggcag
aacaaagtcatccagccctttactgaaagcaaagtctatgaggatttgggattgaacaag
atgcatcgacaaggaaaacttgtctttctcggcgtcgaaggtgatcacttggccatatcc
aaagcctggtttatccaaaacatagttcctcttttactcgaaaagtga

DBGET integrated database retrieval system