KEGG   Drosophila yakuba: Dyak_GE17784Help
Entry
Dyak_GE17784      CDS       T01068                                 

Definition
GE17784 gene product from transcript GE17784-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dya  Drosophila yakuba
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:dya04013]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dya04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:dya04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccgtttaaaaccccctcgggcacagacacacacagt
ttgctggggaagcccaagacgagcatcgatgcactgacagagacgctggagggactggac
atggacgacacggaacgcaagcggatcaaggtgttcctcagccagaaggagaagattggc
gagctgtcggacgaggatctggagaagctgggcgaactgggatcgggcaatggcggcgtg
gtgatgaaggttcggcatacgcacacacacctgatcatggccaggaaactgatccatctg
gaggtgaagccggcaatcaaaaaacagatcctgcgcgaactgaaagtcctgcacgaatgt
aatttcccgcacattgtcggtttctacggcgccttctacagcgacggcgagatcagtatc
tgcatggagtatatggacggaggatcgcttgacctgatcctcaagcgggctggtcgaata
ccggagtccattctcggcaggatcacgcttgcggtgctcaagggcttgagctatctgcgc
gataagcacgccatcatccaccgtgacgtgaagccgagcaatatcctcgtcaacagcagc
ggcgagatcaagatctgtgatttcggcgtctccggccaactgatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcactcactactcc
gtgcagtcggacatctggtcgttgggcctgtcgttagtggaaatggccattggcatgtat
cccatcccgccgccaaacaccgccaccctggagtcgatattcgccgacaatgcggaggag
agcggccagccgacggacgagcccagggcaatggccatcttcgagctgctggattatatt
gtgaacgaaccgccgcccaagctggagcacaagatcttctccaccgagttcaaggacttt
gtggacatctgcctgaagaaacagcccgacgagcgggccgatctcaagactctgctgagt
catccgtggatacgcaaggcggaagtggaggaggtggatatatccggctgggtgtgcaag
acaatggatctgccgccgtcgacgccaaagcgcaatacgtcgcccaactag

DBGET integrated database retrieval system