KEGG   Drosophila yakuba: Dyak_GE17784Help
Entry
Dyak_GE17784      CDS       T01068                                 

Definition
GE17784 gene product from transcript GE17784-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dya  Drosophila yakuba
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE17784
   04068 FoxO signaling pathway
    Dyak_GE17784
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dyak_GE17784
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dyak_GE17784
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dyak_GE17784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccgtttaaaaccccctcgggcacagacacacacagt
ttgctggggaagcccaagacgagcatcgatgcactgacagagacgctggagggactggac
atggacgacacggaacgcaagcggatcaaggtgttcctcagccagaaggagaagattggc
gagctgtcggacgaggatctggagaagctgggcgaactgggatcgggcaatggcggcgtg
gtgatgaaggttcggcatacgcacacacacctgatcatggccaggaaactgatccatctg
gaggtgaagccggcaatcaaaaaacagatcctgcgcgaactgaaagtcctgcacgaatgt
aatttcccgcacattgtcggtttctacggcgccttctacagcgacggcgagatcagtatc
tgcatggagtatatggacggaggatcgcttgacctgatcctcaagcgggctggtcgaata
ccggagtccattctcggcaggatcacgcttgcggtgctcaagggcttgagctatctgcgc
gataagcacgccatcatccaccgtgacgtgaagccgagcaatatcctcgtcaacagcagc
ggcgagatcaagatctgtgatttcggcgtctccggccaactgatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcactcactactcc
gtgcagtcggacatctggtcgttgggcctgtcgttagtggaaatggccattggcatgtat
cccatcccgccgccaaacaccgccaccctggagtcgatattcgccgacaatgcggaggag
agcggccagccgacggacgagcccagggcaatggccatcttcgagctgctggattatatt
gtgaacgaaccgccgcccaagctggagcacaagatcttctccaccgagttcaaggacttt
gtggacatctgcctgaagaaacagcccgacgagcgggccgatctcaagactctgctgagt
catccgtggatacgcaaggcggaagtggaggaggtggatatatccggctgggtgtgcaag
acaatggatctgccgccgtcgacgccaaagcgcaatacgtcgcccaactag

DBGET integrated database retrieval system