KEGG   Drosophila yakuba: Dyak_GE17843Help
Entry
Dyak_GE17843      CDS       T01068                                 

Definition
GE17843 gene product from transcript GE17843-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dya  Drosophila yakuba
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Dyak_GE17843
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dyak_GE17843
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Dyak_GE17843
Transcription machinery [BR:dya03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Dyak_GE17843
Spliceosome [BR:dya03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dyak_GE17843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 469 aa AA seqDB search
MGDFDLNVDSLIQRLLENFKKQKEAEEHAQKLLIAQQLAAAGGATGLSASSPTSSSNYSS
LAAVASSFGSASGYGSGSGAAPGAGAGASAGAGPGSSHDPLDELTEQQRRLLQQYSISPP
SETMISADGDQITVHHPREEPKKSRLKLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKS
REIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLE
TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVA
AIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRG
VSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGM
MTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacttcgatctgaatgtggacagtttgatacagcggctgctggagaactttaaa
aaacaaaaagaggccgaagagcacgcccagaagctgctaatcgctcaacaattggccgcc
gccggcggagcaaccggcttatccgcctcatcgcccacatccagcagcaattactcgtcg
ttggcggcggtggcctcctcctttggttccgcatccggatacggatcgggatctggtgct
gctcctggtgctggtgctggtgctagtgctggtgctgggccaggatccagccatgatccg
ctggacgagctcaccgaacagcagcgccgcctgctccagcaatactcgatatcgccgcca
agcgagacaatgatatcggccgatggcgaccaaatcaccgtccatcatccgcgcgaggag
cccaagaaatccagattgaaactgcgcgattttttcgtcgccgagtttgtgcgcagctgc
cgaacgggcaagcaggtccagatgacggaggcggaggtgcgtggcctctgcctcaagtcg
cgcgagatcttcttgcaacagcccatcctgctggaactggaggcaccgctgatcatctgc
ggcgacatccacggccagtacacagacctgttgcgcctcttcgagtacggcggtttcccg
ccggctgccaactacttgttcctcggcgactacgtcgatcggggcaagcagtccctggag
accatctgcctgctgctggcctacaagatcaaatatccggagaacttcttcttgttgcgc
ggcaaccacgagtgcgccagtattaataggatttacggcttttacgatgagtgcaagcgc
cgatacaacgtcaaactgtggaagaccttcacagattgcttcaactgtctgccggtagcc
gccatcattgacgaaaagatcttctgctgccacggtggcctcagtcccgatcttcaaggc
atggagcagattcgacgcctgatgcggcccacagatgtgccggataccgggttactgtgc
gatctgctgtggagcgatcccgacaaggatgttcagggttggggcgagaacgatcgcggt
gtgagcttcacattcggcgtggatgtggtctccaagttcttgaaccggcacgagctcgac
ttgatctgccgtgcacatcaggttgtggaggatggctacgagttctttgcgcgtcggcaa
ctggtcacgttgttctcggcgcccaactactgtggagagttcgacaacgccggcggaatg
atgaccgtggacgacacgctgatgtgctcattccagatcctgaaaccatcggagaagaag
gccaagtatctgtacagcggaatgaactcgtcgcgacctacaacaccgcagcgcagcgcc
ccaatgcttgcgaccaacaagaagaaataa

DBGET integrated database retrieval system