KEGG   Drosophila yakuba: Dyak_GE17843Help
Entry
Dyak_GE17843      CDS       T01068                                 

Definition
GE17843 gene product from transcript GE17843-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dya  Drosophila yakuba
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dya03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X
AA seq 469 aa AA seqDB search
MGDFDLNVDSLIQRLLENFKKQKEAEEHAQKLLIAQQLAAAGGATGLSASSPTSSSNYSS
LAAVASSFGSASGYGSGSGAAPGAGAGASAGAGPGSSHDPLDELTEQQRRLLQQYSISPP
SETMISADGDQITVHHPREEPKKSRLKLRDFFVAEFVRSCRTGKQVQMTEAEVRGLCLKS
REIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLE
TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVA
AIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRG
VSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGM
MTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRSAPMLATNKKK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacttcgatctgaatgtggacagtttgatacagcggctgctggagaactttaaa
aaacaaaaagaggccgaagagcacgcccagaagctgctaatcgctcaacaattggccgcc
gccggcggagcaaccggcttatccgcctcatcgcccacatccagcagcaattactcgtcg
ttggcggcggtggcctcctcctttggttccgcatccggatacggatcgggatctggtgct
gctcctggtgctggtgctggtgctagtgctggtgctgggccaggatccagccatgatccg
ctggacgagctcaccgaacagcagcgccgcctgctccagcaatactcgatatcgccgcca
agcgagacaatgatatcggccgatggcgaccaaatcaccgtccatcatccgcgcgaggag
cccaagaaatccagattgaaactgcgcgattttttcgtcgccgagtttgtgcgcagctgc
cgaacgggcaagcaggtccagatgacggaggcggaggtgcgtggcctctgcctcaagtcg
cgcgagatcttcttgcaacagcccatcctgctggaactggaggcaccgctgatcatctgc
ggcgacatccacggccagtacacagacctgttgcgcctcttcgagtacggcggtttcccg
ccggctgccaactacttgttcctcggcgactacgtcgatcggggcaagcagtccctggag
accatctgcctgctgctggcctacaagatcaaatatccggagaacttcttcttgttgcgc
ggcaaccacgagtgcgccagtattaataggatttacggcttttacgatgagtgcaagcgc
cgatacaacgtcaaactgtggaagaccttcacagattgcttcaactgtctgccggtagcc
gccatcattgacgaaaagatcttctgctgccacggtggcctcagtcccgatcttcaaggc
atggagcagattcgacgcctgatgcggcccacagatgtgccggataccgggttactgtgc
gatctgctgtggagcgatcccgacaaggatgttcagggttggggcgagaacgatcgcggt
gtgagcttcacattcggcgtggatgtggtctccaagttcttgaaccggcacgagctcgac
ttgatctgccgtgcacatcaggttgtggaggatggctacgagttctttgcgcgtcggcaa
ctggtcacgttgttctcggcgcccaactactgtggagagttcgacaacgccggcggaatg
atgaccgtggacgacacgctgatgtgctcattccagatcctgaaaccatcggagaagaag
gccaagtatctgtacagcggaatgaactcgtcgcgacctacaacaccgcagcgcagcgcc
ccaatgcttgcgaccaacaagaagaaataa

DBGET integrated database retrieval system