KEGG   Drosophila yakuba: Dyak_GE17938Help
Entry
Dyak_GE17938      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform G
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE17938
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE17938
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dyak_GE17938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
X
AA seq 946 aa AA seqDB search
MMLDIKKTRGFHKIPQASKLQSTTKAASSLVATSGKSPNEVPSPGGSAGSRVGATNPVRA
ANQRFFLVSSYKDPTFLKAECELAHAHVTTSKVKTTSQLHRRSRAGEDSRNNNYNASRAP
TLVNMRRTSMFNGNQQQTTTSSTTITNTTSRNSTSNTSNGVLKYSVRSTTATATATSTST
RSYGKLKPLNNNQTTAEAAMMNGHTTNNNNNTSTSSNINNGGNNNMLRQEQQHDDISYID
SDDPPATGGPGGGVSTAKKSICYFKPITPPLQLRHQQNQAQQQEQQPQPSSSKSASHRYQ
RPKSTIIASAHSNFAVSYEKFGGGLYRQANGETNAESRTSSNARKYGIDSLSIKASIEKF
NNLSGQKRQTPGSGSGVGSTSATGSSSGGGPLSGAIRSNHGSQAGGSSSNLQQRYSSDLD
NIRVAAGYSSSLTRAAYRTTATMNSVSAPVAGTSGLGGPIGGSGGGGAATAMVQPTSKVT
VRGTHGNRQPIACDSLAITGKANKDATAAETPTVATATATATATATPTPATSSVSTATAT
ASNSASDSTLARSGTGSSSSARSVLPPMTPTSSRYWDRDSGTSRSSISTSSALNSSSLKH
NSDDGYKSASASRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSSST
KDQQILHEFAKLIQEMWTSNVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLH
SALNSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTS
VTFDPFWDLSVPLPSSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRF
PKYLVIHLKRFSETRWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTA
GGHYVALCKHPVSRKWHEFNDNIVSEALSENHLVSSSAYILFYERT
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagacattaagaagaccagaggattccacaagattccacaggcatccaaatta
cagtcaacaacgaaagcagcatcatcgctagtagccacatcaggaaaaagtccaaacgaa
gtgccatcaccaggaggatcggcaggatcaagagtaggagctactaatccggtgcgagcg
gccaatcagcgcttcttcctagtgtccagctacaaggaccccacatttctgaaggccgaa
tgcgagttggcccatgcgcatgtgacaacgagcaaggtgaaaaccacgtcccagctgcac
aggcggagtcgagcgggtgaggattccaggaacaacaactacaacgctagccgggcacca
acgctggttaatatgcgacgcacgtccatgttcaatggcaatcagcaacaaaccaccacc
agtagcaccaccatcaccaacaccaccagcaggaacagcaccagtaacaccagcaacgga
gtgctcaagtacagcgtccgctccacgacggcaactgcaactgcaacttccacgtctacc
aggagctacggcaagctgaaaccgctcaataataaccaaacgaccgctgaagcagctatg
atgaatggacacaccactaataataataacaacaccagcaccagcagcaacatcaacaac
ggcggcaacaacaacatgctacgccaagagcagcaacacgatgacattagctacatagac
agcgatgatccgccggcaactggtggccctggaggcggagtatcgacagccaagaagagc
atttgctacttcaaacccatcaccccgccgctgcagctgcggcatcagcaaaatcaagct
cagcagcaggaacaacagccgcaacccagcagctccaagtcagccagccatcgctatcaa
cgacccaagtccaccattatagcatcggcccactcgaacttcgcggtcagctatgagaag
ttcggtggtggtctctataggcaggccaatggcgagacgaacgcggagagcaggaccagc
agcaatgccagaaaatacggcattgattcgttgagtatcaaggcctccatagagaagttc
aacaacctcagtggtcagaagaggcaaactccgggctctggctcgggagtaggatctacc
agtgctacagggtccagttcaggaggcggaccgttgtccggagctatccgtagcaatcac
ggatcccaggcaggtggtagcagcagtaacctgcagcagcgctacagcagcgacctggac
aacatccgcgtggcggccggatatagtagttctctgaccagagcagcctatcggactaca
gccacaatgaatagtgttagcgcgccggtagcgggaacctctggattaggcggccctatt
ggcggcagcggaggaggaggagccgccacggcgatggttcagcccacgagcaaggtaacg
gtgcggggtactcacggcaaccggcagccaatcgcgtgcgatagcctggccataaccggc
aaggcaaacaaggatgcaacggcagcagaaacacctactgttgccaccgccactgccact
gccacagccacagcaacacccacaccagccacgtcttccgtctccacagccacagccaca
gcttcaaactccgccagcgatagtacgttggcgagaagcggcactgggagtagcagcagt
gcccggagcgtcctgccgcccatgactcccacgtcaagtcggtactgggatcgggacagc
ggcaccagccgcagcagcatcagcacctcctccgcgctcaactcgtcatccctgaaacac
aattcggatgatggctacaagagcgcctccgcatcgcgggatgagaagtccgaaggtctg
tgcggtctgcgaaacatcgggaacacttgctttatgaactcggtcatccagtgcctgagt
cacacgcaagagctgacccgcttcttgcggtcgcaccacggctctcgttcgtcatccacc
aaggatcagcagatactccacgaatttgccaaactcattcaggagatgtggacctctaac
gtgcacacggtaacgcccatggagttaaagagggcgttctccaccaaacaccgcatgtac
agcgactacaaccaacaggatgcgcaggagtttcttcgtttttttcttgactcgctgcat
tcggccctcaactcgggcgtcaagggtgagacgctcaacattgacgataatctcagtgac
aataagaaggcggacctgacctgggagtggtatacgcggcacgagaactctctggtgcgc
gaccttttcgtgggtcagctcaagagcacactgaagtgcaccacctgcggcaacaccagc
gtcacctttgatccgttctgggatctgagcgtaccgttgccgtcttcttctcgctgcaag
ctagaggcttgcctcgacctctttattcgcgaagaggtccttgacggcgacgaaatgccc
acgtgcgccaaatgcaagacgcggcgaaaatgcaccaaaagcttcaccatccagcgtttc
ccgaaatatctggttatacacttaaaacgcttttcggagacgcgctggagcaagctgtcc
aacatcgttgaatttcctacatcagacagcgagctaaacatggggtcttatggcgccaac
tccaactcaaatgtgcattactcgctctatgcgatatcgaatcatatgggctcaacggct
ggtggtcattatgttgccctctgcaagcatccagtctcccgcaagtggcacgaatttaat
gataatatagtcagcgaggccttgtccgaaaaccatctcgtttcatccagtgcctatatt
cttttctacgagcgtacgtaa

DBGET integrated database retrieval system