KEGG   Drosophila yakuba: Dyak_GE18209Help
Entry
Dyak_GE18209      CDS       T01068                                 

Definition
GE18209 gene product from transcript GE18209-RA
Orthology
K00665  
fatty acid synthase, animal type [EC:2.3.1.85]
Organism
dya  Drosophila yakuba
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dyak_GE18209
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dyak_GE18209
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase
     Dyak_GE18209
Lipid biosynthesis proteins [BR:dya01004]
 Fatty acid synthase
  Animal type
   Dyak_GE18209
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dyak_GE18209
  Exosomal proteins of breast milk
   Dyak_GE18209
  Exosomal proteins of colorectal cancer cells
   Dyak_GE18209
  Exosomal proteins of bladder cancer cells
   Dyak_GE18209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 2409 aa AA seqDB search
MANRKKAQADSAAGEDGDIVISGLSGKLPESSNIEEFKYNLLNGIDMVTDEPRRWEAGIY
GLPERMAKMKDTDLEKFDDKFFSVHQKQAELMDPCMRMLLELTHEAIIDAGINPAQLRGS
RTGVYIGLSFVETEHEIPNMEPSSINGYCLTGCARAMFANRISYTFDFKGPSFIVDTACS
SSLVALNHAFADMRAGRCDYALVAGVNLILKPIFALQFLRLGIVSHDGACKTFDAAANGY
ARADTCAVVLLQRRKEAKRVYASILNVRTNTDGFKEQGVTFPDGRMQQALLEETYSEIGL
NPDEVVYVEAHGSGTPVGDDQEANMLSNFFCRPSRSNPLLIGSVKSNMGHAEPASGVSAL
AKMIIAMEEGIIPKNLHYRTPNPSVPALVEGKLKVVDRNLPWQGGIVGLNSFGFGGANAH
VVLKSHTKAKDPKASPKAGEAEQSLRLVTCSGRTEDAVQQLLKVATEQRHDQELLTLIND
IHSHPIPLHPFRGYAVLGTSGCVKEEVLPYEEEERPIWFVYAGMGSQWASMAKDLMQLEV
FRNSIQHCAEVLAQVDFDLIDVLTRSTERTFDNMLYSFVSVSAVQVALTDLLRVLDIRPD
GIIGHSAGELGAAYMDGCLTAEQTVLAAYWRGRSVLDTPDLPRGKMAAVGLSWEQIGSHI
PKDCYPVCHNSDDNCTVSGPPASMDAMIEELTAKGIFVREVGSGGYAFHSPYIEGAAPML
RSSLERLITKPKKKSIRWLSTSVKEAEWESEKNHLASAGYFINNLISPVLFHQAVKRIPA
NALIVEIAPHGLFRAILRSLSPQISYVSLMQRGHANNFEFLLSQLGRLYAAGGQPQILKI
SPSIPYPVSRGTPMLGSLVGWDHSQKWNYPKFKGGRQAGQLSVELDLGKEENAYLAGHTI
DGRVLFPATGYMTLAWMSLAQQQGLDYLRTPVLFEDVVFHRATILSVGTVVKLALNFFPG
SSSFEICEGTSLVASGKIRLVSNVQQEQLQLSSLPGIAGSNKLSTKDIYKELRLRGYDYS
GVFQGILESDIAAVTGQLQWADNWISFMDTMLQFRILSNDIRELYVPTGIERALIDPLKH
LELAKKHQQKLSVNWHRNISVVKCGGVEIHKMKTAQTQRRSGGQAAPSLERYRFWPNSQH
LGQREEQEKSRSTALAVAIQLIIENSGGAVKLKGVELAGSRTTLDALSAIQLLELIEREP
ILVGDMAVVTSSSSDSELSEQLKEHGIRVIAKDIAAGAVEQQCHFVYAVNMLAQNSVKDL
QHCLDSLKAESGFLLLEETASRYNIIGKEKLNKLKLVPVLEQFFGTDRVLVLVRKLTKVP
SNQDLTLHLTNKQFKWVNELKNSFAKAQAEERNLYLVAQGEPNSGALGLINCLKREAGGN
CLRLYLILDEGLPQFSLEDPFYASQLAKDLVINVYRNGSWGSYRHLKMESRPPMLPVEQA
YVNTLVKGDLSSLRWIESPRSSPTQSQLEPCTVYYAPLNFRDVMLASGKLGVDALPGDLA
YQDCVLGLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEIPSKWTMEQASTVPCVYA
TVYYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFP
KLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIGKFD
LSNNTPLGMSVFLKNTSFHGILLDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFAE
QEIEKAFRFMASGKHIGKVVIKVRLEEEQQAALPRLRQIQAIPRSYMHPEKSYILVGGLG
GFGLELANWLVSRGARFLVLSSRSGVKSGYQALMIRRWHDRGVQVQIDTNDVTTAVGCQR
LLEVSNKLALVGGIFNLAAVLRDGLIEDQSPKNFEKVSAPKLLATIHLDKISREICPALE
YFVCFSSLSCGRGNIGQTNYGLANSTMERICEQRQEYGYPGTAIQWGAIGDTGLIIEHMG
NNETVVGGTLPQRMNSCLETLDLFLQQPHPVMASMVVAEKRKTEQSNRMSLIATIANIMG
LRDVKSVSDKTTLFDLGMDSLMSTEIKQTLERHFDLVLSAQEIRQLTFSALRQIDAQEPP
SASVSSPSATSSLSRTKEEARLEVQPQSDETRKVFAKEVLPQEVMVRLRSKAPVTSEDPA
VFFLAPIEGFTIAVEALAASLTCPAYGLQCTEQVPLDSIEACAAYYLRQIQKLQPLGPYH
IVGYSYGCLLAHAIAVALEQRRFGVKVIMLDGAPTMASGYVQEAKKQTDDLNRQQSMTLA
YFGALLADVDYNQLLQLLDGVQTWSSKLDKLADTLAAHTQQTREVIKKAACMFKQKLLLS
ESYKGAQQLHSDVVLIKSAEHNAIMAQDYGLKEICSAQIDMHVVEGTHRTFLKEPHTLQI
IERVLRKRP
NT seq 7230 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaggaagaaagcccaggcggactcagccgctggcgaagatggagacattgtg
atctctggactctccgggaagctgccggagagcagcaacatcgaggagttcaagtacaac
ctgctcaacggcatcgacatggtcacagatgagccacgccgctgggaggcaggcatctac
ggactacccgagcgcatggccaaaatgaaggacaccgatctggagaagttcgacgacaag
ttcttcagcgtccaccagaagcaggcggagctgatggacccctgcatgcggatgctgctg
gagctgacccacgaggccataatcgacgcgggcatcaatcccgcccagctgcgcggcagt
cgtactggcgtctacattggcctttcctttgtggagacggagcacgagatccccaacatg
gagccgagcagcatcaacggctactgcctgacgggctgtgcgcgggccatgttcgccaat
cgcatctcctacacgttcgacttcaaggggcccagcttcatcgtggacaccgcctgctcc
agctcgctggtggccttgaaccacgcgttcgcggacatgcgggcgggtcgctgtgattac
gccctggtggcgggtgtaaatctcatcctgaagcccatctttgccctccagtttctgagg
ctgggcatcgtgagccacgacggcgcctgcaagaccttcgatgcggcggccaacggctat
gctcgggcggacacctgcgccgttgtgctgctccagaggcggaaggaggccaagcgggtg
tacgccagcatcctgaatgtgcgcacaaatacggacgggttcaaggagcagggcgtcacc
tttccagacgggcgcatgcagcaggctctgctggaggagacctacagcgagatcggcctc
aatccggacgaggtggtctacgtggaggcacacggcagcggcacgccggtgggcgatgac
caggaagccaacatgctgagcaacttcttctgccgcccctcgcgatccaatccgctgctg
attggatctgtgaagtcgaacatgggacacgcggagccagcctcgggagtgagtgccctg
gccaagatgatcatcgccatggaggagggcattattccaaagaatttgcactatcgcacg
cccaatccttcggttccggctctggtcgagggtaagcttaaggtggtggatcggaatctt
ccctggcagggtggcattgtgggtctgaactccttcggctttggaggagccaatgcccat
gtggtgctaaagtcccacactaaagccaaagatcccaaggcatccccaaaggctggagaa
gccgagcaatccttgcggctggttacctgttccggccgcacggaggatgcagtgcaacag
ttgctgaaagtggccaccgagcagaggcacgatcaggagctgctgaccctcatcaatgac
atccactcgcatcctattcccctccatcccttcaggggatatgctgtcctcggaaccagt
ggatgcgttaaggaggaggtgctgccctacgaggaggaggagcgacccatctggttcgtc
tacgccggcatgggcagtcaatgggccagcatggccaaggatctcatgcaactggaggtg
ttccggaactctattcagcactgtgctgaggtgctggcccaggtggactttgatcttatt
gatgtgctgacccgttccacggagcggacctttgacaacatgctgtactccttcgtctcc
gtgtccgccgtgcaggtggctttgacggatctcctccgtgtgctggacatacgcccagat
ggaatcattggccattcggctggggaactgggcgcagcctacatggacggttgtctaacg
gcggagcaaacagtgctggccgcctactggcgcggcaggagcgtcctggacactccggac
ttgccgcgtggaaagatggctgccgtaggcttgagctgggagcagatcggttctcacatc
cccaaggactgctatccggtgtgccacaacagtgatgacaattgcacggtgtctgggcca
ccggcatccatggacgcgatgatagaggagctcacggcgaagggaattttcgtgagggag
gttggctctggcggctatgccttccacagtccgtacatcgaaggagcagcgcccatgcta
cgtagcagtctggagcgactcattacaaagcccaagaagaagagtattcggtggcttagt
acaagtgtgaaagaagcggagtgggagtcggaaaagaatcacctggcatcggcgggctac
tttataaacaacctcatatcccccgtgctctttcaccaagccgtcaagcggattccagca
aacgctctcattgtggagattgcaccccatggactcttcagggcgattctccgatcccta
agtccgcagataagctatgtgagtctgatgcagcgaggtcatgccaataactttgagttc
ttactgagtcagttgggcagactctacgctgccggagggcagccacagatcctcaagatc
tccccttccataccctatcccgtttcccgtggcactcccatgctgggctccttggtgggg
tgggatcactcacagaagtggaactaccccaagttcaaaggcggcagacaggctggtcag
ctcagtgtggaactggatttgggcaaggaggaaaacgcctatctagcggggcacacgatc
gacggcagagtcctatttccggcaaccggctacatgactctggcctggatgagtctggcc
caacagcagggattggactacttgcgcacgcccgtgctattcgaggatgtggtcttccat
cgggccacgatcctcagcgtgggcactgtggtgaagctggcactcaacttctttccgggc
agcagctcctttgaaatctgtgaaggcaccagcctggtggcgtcgggcaagatccgtctg
gtgagcaatgtgcagcaggagcagcttcagctgtcatctctgccgggaatcgccggctct
aacaagctgagcaccaaggacatttacaaggagctgcgacttaggggctacgactacagt
ggtgttttccagggcattttggagtcggatattgcagcggtgacgggtcagttgcagtgg
gcggacaactggataagttttatggacaccatgctgcagttccgcatcctgagcaatgat
atccgtgagctgtacgtgcccacgggtatagagagggcgttgatagatcctctcaagcac
ctggagctggcaaagaagcaccaacagaagttaagtgtcaactggcatcgcaacatttcc
gtggtcaagtgcggtggagtggagatacacaagatgaagaccgcccagacccagaggcga
tctggtggccaagctgcacccagcttggagcgctatagattctggcctaactcccagcac
ttggggcagcgggaggagcaggaaaagtcaaggagtacagccctggcggtggccattcaa
ttgatcatcgagaacagcggtggagcagtgaagctcaagggcgtggagctggccggatcg
cgaaccactttggacgcgctaagtgccatccagctgcttgagctgatcgaaagggaaccg
attctggtgggcgatatggcggtggttaccagctcctccagtgactccgaactgagtgag
cagctgaaggagcacggcattcgggtgatagccaaggatatcgcagctggtgcggtggag
cagcaatgccatttcgtatacgctgtgaacatgctagcccagaactctgtcaaggatctg
cagcactgcttggatagtcttaaggccgagtcgggattcctgctcctggaggaaacggcc
agcaggtataacataataggaaaggagaagttgaacaaactgaagctggtgcccgttttg
gagcagttctttggtacggatcgagtgcttgttctggtcaggaaactaacgaaggtgccg
tccaaccaagacctgacccttcacctaaccaataagcagttcaagtgggtcaacgagctc
aagaactcttttgccaaggcccaggctgaagagagaaacctctacttggtggcccagggt
gaacccaattcaggagctctgggtttgataaattgcctgaagagggaagctggagggaat
tgcctacgcctttacctcattctcgatgagggtctgccccagttctccctggaggatccc
ttctacgcctcacagttggccaaggatctggtcatcaatgtgtacaggaatggaagctgg
ggtagctaccgtcacctgaagatggaatcccgcccgcccatgctgccagtggagcaggcg
tatgttaacaccctggtcaagggggatctctcctcacttcgctggatcgagagtcctcgt
tccagtcccacgcagtcgcagttggagccctgcaccgtttactatgctccgctcaatttc
cgggatgtgatgttggcctccggaaaactgggagtggatgctttgcctggggatctggcc
tatcaggactgcgtccttggtctggagttcgctggcagggattcgtgtggccgtcgtgta
atggccatggtcactgccaaatcgctggccaccaattgcttggccaaccggaatctcctc
tgggaaatcccatcgaagtggaccatggagcaggcttcgacggttccgtgcgtttatgcc
actgtttattacgctttggtggtcaggggtcaaatgaaggagggtgaaaggatactcatc
cacgccggctccggaggagttggtcaggcggccatttcggtggctctggctcacggactg
accgtcttcaccaccgtgggcagcaaggagaagcgggagttcctgctgaagcgattcccc
aagctgaaggctaagaatattggcaactcgcgagacacctccttcgagcaattgatcatg
agtgaaacgcacggaaatggagtggaactggtgctgaactccctttccgaggagaagctg
caagcctccatccgctgcctggctctgaatggtcgcttcctggagatcggtaagttcgac
ttgagcaacaacaccccgttgggcatgtccgtgttcctcaagaacacctccttccacgga
attcttctggacagcgtgatggagggcgaggaggagatgcagctaatggtggccaagttg
gtggcggagggcatcaagagtggggcagtgcagccgctgcccaccaccgtctttgcggag
caggagatcgaaaaggcgttccgcttcatggcctccggcaaacatattggcaaggtggtg
atcaaggtacgtttggaggaggagcagcaggcagctcttccgcgacttaggcaaattcag
gccattccgcgctcctacatgcacccggagaagagctacatcttggtggggggacttggc
ggcttcggtctggagctggccaactggctagtttcccgaggagcccgcttcctggttctg
agctctcgttctggggtgaagagtggctatcaggccctgatgattcgccgctggcacgac
cgtggagtccaggttcagatcgataccaacgatgtgaccactgctgttggttgccagaga
ctcctggaggttagcaataagttggccctggttgggggcatcttcaacctggcggcagtg
ctacgggatggattgatcgaagatcaaagcccgaagaactttgaaaaggtaagtgcacca
aagctgctggccaccattcacctggacaagatctcccgggaaatttgtcctgcactggag
tacttcgtgtgcttctcaagtttgtcctgcggcaggggaaacattggacagaccaactac
ggcctggccaactcaacgatggaaaggatctgcgagcagcggcaggaatatggttatccg
ggcacagcgattcaatggggagccattggagacaccggactgatcatcgagcacatgggc
aacaacgaaactgttgtgggcggcactctgccgcagcggatgaacagctgtctggagacc
ctggacctgttcctgcagcagccgcatcccgtcatggcctccatggtcgtggcggagaag
cgcaagacggagcagtccaaccggatgagcttgatagccaccatcgcgaatatcatgggt
ctgagggatgtgaagagcgtctccgacaagaccaccctctttgacctgggcatggactcg
ctgatgagcacagagataaagcagacgctagagcgtcactttgacctggtcctgagcgcc
caggagatccgccagctgacctttagcgccctgcgccaaatagacgcccaggagccgccc
tccgcttcagtgtcgtcgccctcagccacttccagcctatcaaggaccaaggaggaggcc
aggttggaggtccagcctcagagcgatgagacgcgcaaggtattcgccaaggaagtatta
ccccaggaggtgatggtgcgcctccgttcaaaggcgcccgtgaccagcgaggatccggct
gtgttcttcctggctcccatcgagggattcacaatagccgtggaggcgctggccgcgtcg
ctcacctgccccgcctacgggctgcagtgcacggagcaagtgcctctggactccatcgag
gcctgtgccgcctactatcttcgccaaattcagaagctccagcccctcggaccctaccac
atcgttggctactcctacggctgcctgcttgcccacgccattgctgtggcgctggagcag
cgccgcttcggggtcaaggtcatcatgctggacggagcgcccaccatggccagcggctat
gtccaggaggccaagaagcagacggacgacctcaaccggcagcagtccatgacgttggcc
tacttcggagccctgctcgccgacgtggactacaaccagctgctgcaactcctcgatgga
gtccagacgtggtcctccaagctggacaaactggcagacactctagctgctcacacgcag
caaaccagagaagtgatcaagaaggccgcctgcatgttcaaacagaagctactcctttcc
gagagctacaagggcgcccagcagctccacagcgacgtggtcttgatcaagtcggcggag
cacaatgcgatcatggcccaggactatggcctcaaggagatttgcagtgcccagatcgac
atgcatgtggtggagggcacacacaggacgttcctcaaggagccgcacactctgcagatc
atcgaacgcgtcctgaggaagcgtccctaa

DBGET integrated database retrieval system