KEGG   Drosophila yakuba: Dyak_GE18291Help
Entry
Dyak_GE18291      CDS       T01068                                 

Definition
GE18291 gene product from transcript GE18291-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE18291
Transfer RNA biogenesis [BR:dya03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dyak_GE18291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 554 aa AA seqDB search
MKAKKKLGVGLSRQERQVLVIGEIIQELLKAHEDKKDVNLNRMKSLVSSKYGLDSSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRSRYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMCLP
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLSY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELKGKCSIVRELHVY
GSVVPVNARDPTKFQHQGFGMLLMEEAERISREEHGSTKLAVISGVGTRNYYRKMGYELD
GPYMSKSIEENNLI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaaaaagaagttgggcgtgggattgagccgccaggaacggcaggtgctcgtc
attggggagatcattcaggagctgctgaaggcgcacgaagacaaaaaggatgtaaacctt
aaccggatgaagtcattggtatcctcaaaatatggattggacagttctccgcgcctggtg
gacatcattgcagccgtgccgcaggacgcaaaaaagatcctgcttcccaagctgagggcc
aagcccattcgcacagcaagtggcatcgccgtggttgccgtcatgtgcaagccacatcgg
tgtccgcatatcaacatgaccggtaatatatgcgtctattgtcccggtggaccggacagc
gatttcgagtactcgacccagtcgtacacaggctatgagccgacctcgatgagagcaatc
cggtcgcggtacgatccctttctgcagacccgacaccgcgttgaacaactgaagcaactg
ggccacagcgtggacaaggtggagttcatcgtaatgggcggtacgtttatgtgcctgccg
gaggagtaccgcgactacttcatccgcaacctgcacgacgccctctccggtcacagcagc
gccaatgtggcggaggccgtgcgctactcggagaagtcacgcaccaagtgcattggcatc
accatagaaacaaggccggattactgcctcaagcgtcacatatcggatatgcttagctat
ggttgcacccggttggaaatcggtgtgcaatcagtttacgaagacgtggccagggatacg
aaccgagggcacacagtgcgagcggtatgcgagagcttccagctgggcaaggatgctggc
tacaagatcgtgacgcacatgatgcctgatcttcccaatgtggatttcgaacgcgacatc
gagcagttcatcgagtactttgagaaccctgccttccgctctgatggcctaaagatttat
cccacactcgtaatccgcggcacaggtctttatgagttgtggaaaaccgggcggtataag
tcatatccgccatccatgcttgtagacctggtggccaagattttggcccttgtgccacca
tggacgagagtgtaccgcgtacagcgcgacattcccatgccgcttgttagttccggcgtg
gaacacggaaatctccgagaactggcgctggcccgcatgaaggatcttggaaccacttgt
cgcgatgttagaacccgcgaagttggcattcaggaaatccacaacaaggtgcggccctac
gaaattgagctaattcgtcgggactatgtggccaatggcggctgggaaacattcctctca
tacgaagatcctgagcaggacatcctcgtcggacttcttcggctgcgaaaatgttcaccg
gataccttccgccctgaattgaaaggcaaatgctcaattgtcagggaactgcacgtatat
ggctcagtcgtgccggttaatgctcgggatcccaccaagtttcagcaccagggcttcggt
atgttgctgatggaggaggcagagcgaatatcccgagaggagcacggtagcacaaagttg
gcggtcatatcgggagtgggcaccaggaactactaccgcaaaatgggatacgaactggac
ggaccctacatgtcaaagagcatagaggaaaataacttaatctag

DBGET integrated database retrieval system