KEGG   Drosophila yakuba: Dyak_GE18522Help
Entry
Dyak_GE18522      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dya  Drosophila yakuba
Pathway
dya00062  Fatty acid elongation
dya01100  Metabolic pathways
dya01212  Fatty acid metabolism
dya04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Dyak_GE18522
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE18522
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dyak_GE18522
Lipid biosynthesis proteins [BR:dya01004]
 Fatty acid synthase
  Component type
   Dyak_GE18522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2 PGAP1 Abhydrolase_1 Abhydrolase_6 DUF2974 FSH1 Hydrolase_4 Peptidase_S9 Abhydrolase_2 PE-PPE Cutinase
Motif
Other DBs
NCBI-GeneID: 6527260
NCBI-ProteinID: XP_002088354
FlyBase: FBpp0263532 FBgn0235933
UniProt: B4P1F9
Position
2L
AA seq 316 aa AA seqDB search
MQVARRRAANKDTNTSTTTVENPLFPHKMRLHLQVLVALITCSAVPGTLAYKPVVILHGI
LSGAESMASLVREIEEFHPGTIVYNCDKFSGWYSLENAWRQVDQVRDYLNEVGKLHPEGI
IVLGYSQGGLLARAAIQSLPEHNVKTFISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFY
SRVGQHTSVGGYWNDPQRQDLYMKYSEFLPLINNEKKSSNSTSFKMGMVRLDKLVMIGGP
NDDVITPWESSHFSYFDENMDVIPFIKRTIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAW
HTRRDVIHEVIMPYLD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtagcaagaagaagagcagctaataaagatacgaatacatcaacaacaacagtc
gaaaatccattgttcccccacaaaatgaggcttcatttgcaagtcctggtggctctgata
acctgctcggccgttcccggcacactggcctacaagccggtggttatcctacacggaatt
ctctccggagcggaatcgatggcttctctggttcgggaaatcgaagagttccatcctggc
accatcgtctacaactgcgacaagttcagtggatggtacagcttggagaacgcctggcga
caggtcgatcaggtcagggattacctcaacgaggtgggcaaactgcatccggagggcatc
atagtgctgggatactcgcaaggaggccttttggcccgggcggccatccaaagtctgccc
gagcacaatgtgaagacctttatatcgctatcctcaccacaggcgggacagtacggcacc
agcttcctgcatctgatatttcccgatttggcggccaagacggccttcgagttgttctac
tcgcgcgtgggacaacacacctcggttggtggctactggaacgatccgcagaggcaggat
ctctacatgaagtacagcgaattcctgccattgatcaataacgagaagaagtcctccaac
tccacatccttcaagatgggaatggtgcggctggacaagttggtgatgatcggcggaccc
aacgacgatgtgattactccgtgggaatcgagccactttagttacttcgatgagaatatg
gatgtgattccttttatcaagcgaacgattttcaccagcgattccattggcatcaggacg
cttcaggaggctggcaagctcatcattgtggtcaaaccccatgtccaccatctagcctgg
cacacgcgaagggatgtcatccacgaagtgataatgccctatctggactga

DBGET integrated database retrieval system