KEGG   Drosophila yakuba: Dyak_GE18522Help
Entry
Dyak_GE18522      CDS       T01068                                 

Definition
GE18522 gene product from transcript GE18522-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dya  Drosophila yakuba
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dyak_GE18522
  Lipid metabolism
   00062 Fatty acid elongation
    Dyak_GE18522
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE18522
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dyak_GE18522
Lipid biosynthesis proteins [BR:dya01004]
 Fatty acid synthase
  Component type
   Dyak_GE18522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 288 aa AA seqDB search
MRLHLQVLVALITCSAVPGTLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDK
FSGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFI
SLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYMKYSEF
LPLINNEKKSSNSTSFKMGMVRLDKLVMIGGPNDDVITPWESSHFSYFDENMDVIPFIKR
TIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIMPYLD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcatttgcaagtcctggtggctctgataacctgctcggccgttcccggcaca
ctggcctacaagccggtggttatcctacacggaattctctccggagcggaatcgatggct
tctctggttcgggaaatcgaagagttccatcctggcaccatcgtctacaactgcgacaag
ttcagtggatggtacagcttggagaacgcctggcgacaggtcgatcaggtcagggattac
ctcaacgaggtgggcaaactgcatccggagggcatcatagtgctgggatactcgcaagga
ggccttttggcccgggcggccatccaaagtctgcccgagcacaatgtgaagacctttata
tcgctatcctcaccacaggcgggacagtacggcaccagcttcctgcatctgatatttccc
gatttggcggccaagacggccttcgagttgttctactcgcgcgtgggacaacacacctcg
gttggtggctactggaacgatccgcagaggcaggatctctacatgaagtacagcgaattc
ctgccattgatcaataacgagaagaagtcctccaactccacatccttcaagatgggaatg
gtgcggctggacaagttggtgatgatcggcggacccaacgacgatgtgattactccgtgg
gaatcgagccactttagttacttcgatgagaatatggatgtgattccttttatcaagcga
acgattttcaccagcgattccattggcatcaggacgcttcaggaggctggcaagctcatc
attgtggtcaaaccccatgtccaccatctagcctggcacacgcgaagggatgtcatccac
gaagtgataatgccctatctggactga

DBGET integrated database retrieval system