KEGG   Drosophila yakuba: Dyak_GE18537Help
Entry
Dyak_GE18537      CDS       T01068                                 

Definition
GE18537 gene product from transcript GE18537-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE18537
   00052 Galactose metabolism
    Dyak_GE18537
Enzymes [BR:dya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dyak_GE18537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 368 aa AA seqDB search
MSITVEEKNFGLATNPLTEARQMVRCYTLKNTKGMSVSLIQLGATIQSISLPDGSKKVED
VCLGFDDIAGYVTNKAAYIGGTLGRVANRVANGGFTMDDTTVNLTRNVEDQFHLHGGFVG
FDSVIWEVEQKTPQGVVFRHESPHGHEGYPGTLRCLVTYRLDNENRLFISYEATTDRPTI
VNLSSHVYLNLAGHNAGPKGLAEHTVEIASSEIVATDDMQIPTGQLTLVDNTVFDLRSPV
VLGERLKQFEDRPIKGFDNCYVVNGGQLLRSTVKVAKIVHPPSGRALEVWTDQPGMQFYT
ANNITKMAGKKGFHYVKHGSFCVQTEKFPDAVNHQKFPSINLDPHETYRHEVVYWFKIEK
ICRCCYKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaccgtagaggagaaaaacttcggtctggccaccaacccgctaaccgaagcc
cggcaaatggttcgctgctacaccctaaagaacaccaagggcatgtccgtgtcgctcatc
cagctgggggccaccatccagagcatctccctgccggatggctccaagaaggtggaggat
gtgtgcctcgggttcgacgacatcgctggctatgtgacaaacaaggcggcctacatcggt
ggaaccctagggcgagtggccaaccgtgtggccaacggtgggtttaccatggatgacact
acagtcaacctgacgaggaacgtcgaggatcagtttcatctgcacggtggcttcgtggga
tttgacagcgtcatttgggaagtggagcagaagacaccacagggtgtggtttttcgccat
gaatccccacatggtcacgagggctatccaggcactctcaggtgccttgtcacctaccgc
ctggacaatgagaaccgtttgttcattagttacgaggccaccacagatcgcccgacaatt
gtcaatctctcgagccacgtctatttaaatctagctggtcataatgcaggtcccaaagga
cttgcagagcacacggtggagatagcttccagtgagattgtagcaacggatgacatgcag
atcccaacagggcagttaaccctggttgacaacacggttttcgatctccgatcacctgtg
gtcctgggagagcgcctcaagcagttcgaggatcgtcccatcaagggtttcgacaactgc
tatgtggtcaatggaggtcagctattgagatcgaccgtcaaggtggccaagatagtgcac
ccgcccagtggccgagctctggaggtctggacagatcagccaggcatgcaattctatacc
gcgaacaacataaccaaaatggctggcaagaagggattccattatgtgaagcacggatcc
ttctgtgtccaaacggagaagtttcccgacgccgtcaatcaccagaaattcccgtcaatc
aatctagaccctcatgaaacataccgtcacgaagttgtatactggtttaagatcgaaaag
atctgcaggtgctgttataaaaagtaa

DBGET integrated database retrieval system