KEGG   Drosophila yakuba: Dyak_GE18612Help
Entry
Dyak_GE18612      CDS       T01068                                 

Definition
GE18612 gene product from transcript GE18612-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dya  Drosophila yakuba
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dyak_GE18612
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dyak_GE18612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1832 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLVFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHAAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICFDEANGSFNADLAAG
KDQKGVTRDDRIHGGLIVFNELFRCANATWEQRYSSLKTLFPKTQHNKFLEASSSSGMGS
HLNTLVPRLKVPFIDKLGSTQTHLGEGEHHKGVAKFASHNVLESAYAQEILQEHYTTICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAYI
TIGYMAVAVQSAIEVHLSSIMTSVKVALPAKDLTSKRKVPVDPAVFACITLLAHAVKSEI
ADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKATVVPYT
AMPSIAIDGSLMQNADGATTVLALKTLGTFNFEEQNMLDFVQRCADFFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLIVAITDMDCNVRIRILRSLDETFD
AKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELITDLKYS
GMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA
EVNGGSDEMELWADELLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE
SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKC
VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINT
PLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGST
LGYYLPLIVPPIVKLFDSPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDTE
PELRDQAMITLRSLVKQLGKKYLVFVPMVQRTLNKHRISDPEYEKQLSKIQSNSTLADSS
GAGESDLRTAKFKNNEPFVTDRNSNNKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRLSI
GLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQVTD
MPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDSQVF
ESLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYERNLKTDSSD
LEARLGHMRCLEALGDWSELSNVTKHEWETFGTEAKSRAGPLAAVAAWGLQDWEAMREYV
RCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCV
QMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDDIHTW
LKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPHQPLPCNQPQVTYAYTKYMAANNQLQDA
YEQLRHFVNTYSQELSCLPPEALKQQDQRLMARCYLRLATWQNKLQDSIGPEAIPGALEC
FEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGMTMGLGLDSDLMIIQQ
YAVPAVQGFFRSISLIKGNSLQDTLRLLTPLV
NT seq 5499 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccgaaat
gttcagaacaaggccacccaggatctagtcttctatgttaagacagaactgcgcgagatg
tcccaggaggagctggcgcaattcttcgacgagttcgaccaccacatcttcacgatggtg
aatgcgacggacatcaacgagaagaagggtggtgccctggccatgaagtgcctgattaac
tgcgaaggcagtctaactgccaggaagggaatttcgccctatctcaaccgcctgcgcgat
cttcttctgatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaaattg
gccaacatgcccacgtccaagggagccgactcattcgacttcgatattaagaaggctttt
gaggtgctcagaggcgagagacaagagtaccgccgccatgcagccgtctttatcctccgt
gagctggcgatcgccttgccgacatacttctaccagcacatcctgaccttctttgaggtt
atctttaacgccatcttcgatcccaaacctgccatacgagagtctgctggcgaggctttg
agggcggctttaattgtaaccgcgcagcgagaaagcaccaaacagtccagtgaaccacag
tggtacagaatctgctttgacgaggctaatgggagcttcaatgcagacctggccgctggc
aaggatcagaagggcgtgacccgagacgatcgcattcacggtggcctcatcgtcttcaac
gagctctttcgctgtgccaatgccacatgggagcagcgctactcgtcgctgaagacgctg
tttcccaaaacccaacacaacaagttcctggaggccagcagttcgtcgggtatgggttcc
catctgaacactctagtgccgcggctaaaggtgcccttcattgacaagctcggcagcacc
caaacacatttgggcgagggagagcatcacaaaggagtggccaagttcgcgagccacaac
gttctggagtccgcctatgctcaggagatcctccaggagcactacaccaccatttgcgat
aatgttttggagcagcgaacttccaagtccccgtatgttcagcaggcactccttcaaata
ctgccccgattggctgcttttaaccgcgctgtttttgtggaaaaatacctgcagacatgc
gtgtcgcatttaatgcagatcctgcggggcaaggagaaggatcgcacggtggcctacatt
actattggttacatggctgtggcagtgcagagtgcgatcgaagttcatctatccagtata
atgaccagcgtgaaggtcgctttgccggcaaaggatttgaccagcaaacgaaaggtacca
gtggatccggcggtatttgcctgcattacgcttcttgcgcatgccgttaagtcggagata
gccgacgatgttaaggatatccttgagcagatgttctatacgggtctttcgccagctctg
actgtgtgcctaagagaactctccgagaatgtgccgcaacttaagtcggccattacagaa
ggattgatcggaatcctgtcccaagtactgatgaacaaggcgactgttgtaccatacact
gctatgccatccatcgccattgatggctcgctgatgcagaatgctgacggtgccaccaca
gtgctggcactcaaaacactgggtaccttcaactttgaagagcaaaacatgctggacttc
gtgcaacgatgtgccgacttcttcattgtacacgagcagcaggagattcgtctggaagca
gtgcaaacctgcacacgactcctcaaactggcagtgcaatcctctgaaagtatggagaac
tccaagactctcagcgacaccgtttcccacgtcattgagcgcctgctaatagtggcaatt
actgatatggactgcaatgtgcgaatacgtattttacgttcgctggacgagacctttgat
gcgaagcttgctcagccagagtctctaaattcattatttattacgctgcatgacgaaatc
ttcgagatccgcgaactggcaatggttaccattggaagactgtcgtccatgaacccggct
tatgtgatgcccaaattaagaaccaccatgattgagttaatcacggatctgaagtactcg
ggaatgagtcgaaacaaggagcagagcgccaagatgcttgaccatctggtgataagtacg
cccaggctaatatcctcgtacatgaatccgatccttaaggccttagtgcccaagttgcat
gagccggaatctaatccaggagttattttgaatgtgctgcgcaccattggtgatctagca
gaggtaaatggaggctccgatgaaatggaactgtgggcagacgagcttctatctatttta
ctcgaaatgcttggggacgctggcagtccggataagcgaggcgtggctctgtggaccttg
ggacagttaatcagtgcaacgggcagggtggttagcccatatcacaagtaccccgtgctc
atagacattttgattaatttccttaaaacggagcaacgtcgttccatacgaagggaaaca
atccgagtgctgggccttttgggagccatggatccctacaagcacaaaatgaacaaaggc
ttgattgatagccaaaaggataatgttttaatagcatactccgatggcaaggtagatgaa
agtcaggacatatccaccgctgagctgctggttaatatgggtaacgcgttggatgagtat
tatcccgctgtggccatagctgccttgatgaggatcctacgcgatcccacgctaagtact
cgccacaccagtgtggtgcaggcggtgacatttatctttcaaagcctgggcatcaaatgt
gtgccgtacttggcccaagtgcttccaaatttgctggacaacgtacgcactgcggataac
aatctaagggagttcctcttccagcagctggccattttggtcgcttttgtgaagctgcac
atcattagctacatgggagatattttcaagttgatcaaagagttttggacaattaacacg
ccactgcaaaacactttaatcaatttgattgaacagatcgccgtggctttgggctgcgag
tttagggattatttggcggagctgatcccacaaattctacgagtgttgcagcacgataac
tccaaggatagaatggtcaccaggaggctgctccaagcactccaaaagtttggcagcacc
ttggggtactatctgccgctgattgtgcctccaattgtgaaactcttcgattctccgtat
gtaccacagcaggtgtcaatggttgccctggaaacgatcaacaatcttgcctgccagctg
gacttcaccgacttctcctcgcgcatcatacatccgttggttcgagtgctggacactgaa
ccagagcttcgggaccaagccatgattaccctccgctcactggtaaagcaactgggcaag
aagtacctggtgttcgtgccaatggtccagcgcactctcaacaagcatcgcatttcggat
cccgaatacgagaagcaactgagtaagattcagtccaacagcacactggcggattcctct
ggggccggagagtcagatttgcgcacggccaagttcaaaaacaacgagccatttgtgact
gaccggaatagtaataataaaaatctgcaggttaccacaaacgaactacgaacggcgtgg
caggtgacgcgtcgggtgtccaaagatgactgggtggagtggctaaagaggttgtccatt
ggcctgctaaaggaatcgccctcgcacgcactaagagcctgtcgttcgttggcccaagag
tacgatacgctgttgcgagatcttttcaatgccgcatttatctcctgttggacggaactt
tcgccagatctgaagaacgagcttactcagtcgctgattcaagccctgcaagttaccgac
atgccggaaatcactcagacaatcctcaaccttgctgagttcatggagcattgtgaccgc
gatccaataccaatagagactaagctattgggtactcgagcgatggcttgcagagcctat
gccaaagcattgcgttacaaggaggaggagtttctgctgcgggaggactcccaagttttc
gagtccttgattctaatcaacaacaagctgcagcaaagagaagcagcggaaggtctgctt
acaacctatcggaatgcagccaacgaactaaatgttcaaggaagatggtatgaaaagctt
cacaactgggatcaggcgctggaacactatgaaaggaatctaaagacggattcctcggac
ttggaggcccgcctcggtcacatgcgctgcttggaggccctcggagattggtcggagctg
agcaacgtgacgaagcacgagtgggaaaccttcggtacggaggccaaatcaagagcagga
cccttggctgcggtagctgcgtggggtctgcaggactgggaagcgatgcgggagtacgtg
aggtgtataccagaggatacccaagatggaagctactatcgagctgtgctcgcggtgcat
catgacgactttgagaccgcacagcgccttattgacgaaacgagagacctcctggacacg
gagctcacatcgatggcgggcgagtcctatgaaagagcctacggcgccatggtatgcgta
caaatgctggcggagctggaggaggtcatccagtacaagctgatcccagagaggcgagag
cccctaaagaccatgtggtggaagcgtcttcagggagggcagcgactggtagaggactgg
cgaagaatcatacaggtgcactcgctggtggtaaaaccgcacgacgacatacacacctgg
ctgaagtacgctagtttgtgcagaaagagcggttctctccacttgtctcataaaactctg
gtgatgctacttggcaccgatcccaagctgaatccgcaccagccactgccgtgcaatcaa
ccccaggtgacttatgcgtacaccaagtacatggctgccaataatcagctgcaagatgcc
tacgaacagttgaggcacttcgtaaacacctatagtcaggagctaagctgcctgcctccg
gaagcactgaaacagcaagatcagcgactcatggcacgctgctatctgcgcttggccacc
tggcagaacaagctgcaggacagcatcggaccggaggccataccaggcgccctcgagtgc
ttcgaaaaggccactagctacgatcccaactggtacaaggcctggcacctgtgggcgtac
atgaactttaaggttgtgcaggcccaaaaatcggcgctggacaaacaacagcctccgggg
gccagtatgggaatgacaatgggcttgggcctcgacagtgatctaatgatcatacagcaa
tacgccgttccggcagtccagggattcttccgttcaatcagccttataaagggcaattcg
ctgcaggatacgctacgtctcttaacccctttggtttga

DBGET integrated database retrieval system