KEGG   Drosophila yakuba: Dyak_GE18613Help
Entry
Dyak_GE18613      CDS       T01068                                 

Gene name
dyak_GLEANR_2402
Definition
(RefSeq) GE18613 gene product from transcript GE18613-RA
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
dya  Drosophila yakuba
Pathway
mTOR signaling pathway
Longevity regulating pathway - multiple species
Jak-STAT signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dyak_GE18613 (dyak_GLEANR_2402)
   04150 mTOR signaling pathway
    Dyak_GE18613 (dyak_GLEANR_2402)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dyak_GE18613 (dyak_GLEANR_2402)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    Dyak_GE18613 (dyak_GLEANR_2402)
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dyak_GE18613 (dyak_GLEANR_2402)
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dyak_GE18613 (dyak_GLEANR_2402)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
Position
2L
AA seq 623 aa AA seqDB search
MKLIEINTWLQVIPQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLA
RRNAAFKILDSMRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKG
MFEILEPLHAMLERGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYH
VFQKISRQLPQLTSLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSK
QRPRKLCIRGSNGKDYMYLLKGHGDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYA
VIPLSTNSGLIGWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEV
FEHALGQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLML
DRMSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLV
LRRNKDSLMAVLEAFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVED
SLPMAKSKPYDPTLQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTQKSVNEQQQVE
LLIQQATNNENLCQCYIGWCPFW
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatcgagatcaacacctggcttcaggttatcccgcagctaattgcccgcatc
gatacccaccgtcagttggtgggtcaactgatccaccagctccttatggacataggaaag
aatcacccgcaagctttggtctatcctctaacagtcgcttccaagtcggcgtcattggcg
cggaggaatgccgcatttaagatcctcgactcgatgagaaaacactcgcccactttggtg
gagcaggcggtcatgtgcagtgaggagctcatccgtgtggcgatcctgtggcacgaacag
tggcacgagggtttggaggaagcgtcgcgactttactttggagatcgtaacgttaagggc
atgtttgagattttggagccactgcatgctatgctcgagaggggaccgcaaacgctcaag
gagacatccttctcgcaggcctatggacgcgagctgacggaagcctacgagtggtcgcag
cggtacaagacatcggcggtggtgatggatctagatcgagcctgggacatctactatcac
gtcttccaaaagatctcgcgccagctgccacagcttacctcgctagagctgccgtatgtc
tcgcccaaactgatgacgtgcaaagatctcgagctggccgtacccgggtcctacaatcct
ggccaagagctcatccggattagtatcattaaaacaaaccttcaggtgattacatccaag
cagcgcccacgaaaactgtgcattcgtggctccaacggcaaggactatatgtaccttcta
aagggacacggggatcttcgtcaggacgaacgcgtgatgcagctattttccttggtgaat
acattgctattggatgacccggacacgttccgacgtaacctggctatccagcggtatgct
gttatcccgctcagtaccaactcgggccttattggttgggtgccacattgtgacaccctg
cacacgcttatccgcgactaccgcgacaagaagaaggtgccacttaatcaggagcatcgc
acaatgctcaattttgcgccagactatgatcacctcacgctgatgcagaaggttgaagtg
ttcgagcatgcgttgggtcagacgcaaggcgacgacttggccaagttgctgtggctgaag
tccccgtcctccgaattatggtttgagcgaagaaacaactacacccgctcattggcagtc
atgtctatggttggatacatcctgggtctgggcgatcgccatccatcgaatcttatgctg
gatcgcatgagcggcaagatactgcacatagattttggcgactgcttcgaggtggcaatg
acgcgcgaaaagtttcccgaaaagatacccttccgtctcacccggatgctaatcaaggcg
atggaggtcactggcatcgagggtacctacaggcgcacttgcgaaagcgtaatgctggtg
ctccggcgcaacaaggactccctcatggcggtgctggaggcgtttgtctatgatccgctg
ctcaactggagactgttggatgtggacaagaagggtaacgatgcggtggctggggcgggt
gctccaggcggaagggggggttccggaatgcaggacagcctcagcaactccgtggaggac
tccctgcccatggccaagtcgaagccctacgatcccacgctgcagcagggcggcctgcac
aacaacgtggccgacgagacgaacagcaaagccagccaggtaatcaagcgggtcaagtgc
aagctaactggcaccgacttccagacgcaaaagagcgtaaacgagcagcagcaagtggag
ctgctcatccagcaggcgaccaacaacgagaacctctgccagtgctacattggctggtgt
ccgttttggtag

DBGET integrated database retrieval system