KEGG   Drosophila yakuba: Dyak_GE18685Help
Entry
Dyak_GE18685      CDS       T01068                                 

Definition
GE18685 gene product from transcript GE18685-RA
Orthology
K03099  
son of sevenless
Organism
dya  Drosophila yakuba
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE18685
   04630 Jak-STAT signaling pathway
    Dyak_GE18685
   04068 FoxO signaling pathway
    Dyak_GE18685
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dyak_GE18685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1585 aa AA seqDB search
MFSGPSGHAHTISYGGGIGLGTGGGGGGGGTQGGGGGGVGIGGGGVAGLQDCDGYDFTKC
ENAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEE
KVNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLVAV
LEYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQ
RASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYEVTV
TLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLLSKP
GASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQVQGL
LHPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNEFIR
EDSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRRVDI
NDRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSILQDI
ERKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYADPTF
VRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGAAGAGGIGGVGGDKEHKNSHRE
DWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLSFLEHVNGKSMRKWVDS
VLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFE
MYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQR
AIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHLKK
YQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQN
QPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPL
KSPGIKPRRQNQTNSSSKLSNSTSSGAAAAAASSTATTIATAAAPSLHASSIMEAPTAGA
IAGSGTLAGEQSPQHNPHAFSVFAPVIIPERNTSSWSGTPQHTRAEQNNGEVSVPAPHLP
KKPGAHVWANHSTLASSSAMDVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLPKLVVSP
RHETGNRSPFHGRMQNSPTHSTASTVTLTGMSASAGEEFCPGGFYFNSAHQGQPGAVPIS
PHVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPP
RLNHSTGISYLRHNHSHGKSKEFVGKSSLLLPNTSSIMIRRNSAIEKRAAATTQPSAVGP
ISTTLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVESTSSSYAH
QLRMRQQQAHPAIYSQHHHATHLPHHQHQHHSNPTQSRSSPKEFFPIATSLEGTPKLPPK
PSLSANFYNNPDKGTMFLYPSTNEE
NT seq 4758 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccatcagctacgggggcgggatcggtctg
ggcaccggaggcggtggtggtggaggtggcacccagggcggcggaggcggtggtgttggc
attggtggcggtggcgtggctgggctgcaggactgcgatggctatgacttcaccaaatgc
gagaatgctgcgagatggaggggcttgtttacgccgtcgctgaagaaggtgctggagcag
gtgcatccacgggtcaccgccaaggaggacgctctgctgtatgtggagaaactctgccta
cggttgctggctatgctgtgcgccaaaccgctgccccactccgttcaggatgtggaggag
aaggtgaacaagtcctttccggcgcccatcgatcagtgggccctcaacgaggccaaggag
gtgatcaactcgaagaaacgcaagtctgtcctgcccacggaaaaggtgcacacgctgctc
cagaaggatgtgctgcagtacaagatcgacagctccgtgtccgccttcctggtggccgtg
ctggagtacatctctgcggacatactcaaaatggccggcgactatgtgatcaagatcgcc
cactgcgagattaccaaggaggacatcgaggtggtgatgaacgccgatcgcgtcctaatg
gacatgctcaaccagagtgaagcccacatcctgcccagtcccctgtcactgcccgcccag
cgagcaagtgccacctacgaggagacggtcaaggagctgatccacgacgagaagcagtac
cagcgcgacctgcacatgatcatacgcgtctttcgcgaggagttggtgaagatcgtgtcc
gatccccgggagctagaaccgatattctccaacataatggacatttacgaagtgacggtg
actctgctcggctccctggaggacgtcattgagatgtcccaggagcagagtgccccctgt
gtgggcagctgctttgaggaactggccgaggccgaggagttcgacgtgtacaagaagtac
gcctacgatgtgacctcgcaggcctcacgggatgcactcaacaatctcctgtccaaacca
ggggcctcatccctgaccacagccggccatggctttcgcgatgctgtcaagtactatttg
cccaagctgcttctggtgcccatttgccatgccttcgtgtactttgactacatcaagcac
ctcaaggatctcagctcgtcgcaggacgacatcgagagcttcgaacaggtccagggcctg
ctgcatccactccactgcgatctcgagaaggttatggccagcctgtccaaggagcgacaa
gttcccgtcagcggccgagtgcgccgccagctggccatcgagcggacgcgggagctccaa
atgaaggtcgagcactgggaggacaaggacgtgggccaaaattgcaatgaatttattcgc
gaggattcgctaagcaagcttggatcaggaaaacgaatctggagcgagcgcaaggtgttt
ctcttcgatgggctgatggtgctatgcaaggcaaacaccaaaaagcaaacaccatcggca
ggagcaacggcctacgattaccggctgaaggagaagtattttatgcgacgcgtagatatc
aacgaccgaccagacagcgatgacctgaagaacagcttcgagttggcgcccaggatgcag
ccgccaattgtgctgaccgccaagaatgcacaacacaagcacgattggatggcggacctg
ttgatggtgatcaccaagtcgatgctggacaggcacttggacagcatactgcaagacatc
gagcgaaagcacccactgcgtatgcccagcccggagatttacaagttcgcggtgcccgac
agcggtgacaatatcgtgttggaggagcgcgaaagcgcaggagtgccgatgatcaaggga
gcgacgctttgcaagctgatcgagcgcctcacctatcacatctacgccgacccgaccttc
gtgcgcaccttcctcaccacatatcgctacttctgctcaccgcagcaattgctgcagctg
ctagtggagcgcttcaacataccggatcccagcttggtctatcaagacacgggtgcagca
ggtgcgggaggcatcggcggcgttggcggtgacaaggagcacaagaactcgcatcgcgag
gactggaaacgctatcgcaaggagtatgtgcagccagtgcagtttcgagtgctcaacgtg
ctgcgccattgggtcgaccaccatttttacgatttcgagaaggatcccatgttgctggag
aagctgcttagctttctggagcacgtgaatggcaaatcgatgcgcaagtgggtggattcc
gtgcttaagattgttcaaagaaagaacgagcaggagaaaagcaataagaagattgtatac
gcctatggccacgatccgccgcccattgagcatcaccttagcgtacccaacgacgagata
acgctcctcaccctgcacccactggaactggcccgtcagctaactctgctggaattcgag
atgtacaagaatgtaaagccctcggagttggtcgggtccccctggacgaaaaaggacaag
gaggtgaagagccctaatttactgaagatcatgaagcacaccacaaacgtgacccgctgg
attgagaaatccataaccgaagcggagaattacgaggaacgccttgcaattatgcaacgc
gcaattgaagttatgatggtgatgctggaattgaacaattttaatggaatcctctcaatt
gtcgcggcaatgggcacggcatcagtttatcgactgcggtggacattccagggattgccc
gaacgctacagaaaattcttggaagaatgccgcgagcttagtgacgatcatctcaagaag
tatcaggaacgattgcgatccatcaatccgccttgtgtgccatttttcggtcgctacttg
accaacatactccacttggaggagggaaaccccgacctgctagccaacacagagctaatt
aacttttcaaaacgacggaaagtggccgagattattggcgaaattcaacagtaccagaac
cagccatactgtctcaacgaggagtccacaatacgacagttcttcgagcaactagatccg
ttcaacggactgtccgacaaacagatgtctgactatctctataacgaaagcctacgcatt
gagcccaggggttgcaagacggtgccgaaattccctcgaaagtggccgcacattccgctc
aaatcgccgggcatcaagccgcgtcggcagaatcagaccaacagcagtagcaagctgtcg
aacagcacgtcgtcaggggcggcggcagcggcagcatcgtcaacggccaccacaatagcg
actgcagcagctccatctttgcacgcatccagcataatggaagcgccaacagcaggcgca
attgctggatctggaactctcgccggcgagcaaagtccgcagcacaatccgcacgctttc
tccgttttcgcccctgttattatacccgaacggaatactagcagctggagtggaacgcca
cagcacactcgggcggaacagaacaacggggaggtttcggtgccggcgccacatctcccc
aagaaaccgggcgcgcatgtctgggctaaccactcgacattggccagttcgtcagcaatg
gatgtgttcagtccagcgctgccggagcacctgccgccgcagtccctgccggacagcaat
ccatttgcatcggacacggaagctccgccctcgccgctgcccaagctagtggtcagtccg
cgtcacgaaaccggcaatcgctcaccattccatgggcgtatgcagaacagcccaacgcat
agcactgccagcaccgtgaccctaacaggcatgtctgcatcggccggggaggagttctgt
ccgggtggcttctatttcaacagcgcccatcagggacagccgggggcagtgcccatctca
ccgcatgtcaatgttccgatggccaccaatatggagtaccgcgcagtgccgcctccactg
ccacccagacgcaaggagcgcactgagagctgtgcggacatggcgcaaaagcgacaggcg
ccagacgcacccacattacccccgcgtgatggcgaactcagtccgcccccgataccgcca
cggctcaaccattccacgggcatcagctacttgcgacataaccatagccatggcaagagc
aaggagtttgtgggcaagagcagtctgctcctgcccaacaccagcagtattatgatacgc
cgcaactcggcgatcgagaagcgggcagcggcaactacccagccgtcggcggttggaccc
atcagcacgacactagtgaccgtgtcgcaggcggtggcgacggacgaaccgctgccgcta
ccaatctcgccagcggcaagctcctcgacgaccacatcaccgctgacacccgccatgtcg
ccgatgtcccccaacattcccagccatccggtggagagtacgtcgagcagctatgcccac
caactgcgaatgcggcagcaacaggcgcatcccgcgatctactcgcaacaccatcatgct
acccatctcccgcaccatcagcaccagcaccattcgaatccgacgcagtcccgctcgtcc
ccgaaggagttctttccgattgccacgagcctcgagggcacacccaaacttccaccaaaa
cctagtctaagcgctaacttctataacaatccagataaaggtacgatgtttctttaccca
agtacaaacgaagaataa

DBGET integrated database retrieval system