KEGG   Drosophila yakuba: Dyak_GE18685Help
Entry
Dyak_GE18685      CDS       T01068                                 

Gene name
dyak_GLEANR_2470
Definition
(RefSeq) GE18685 gene product from transcript GE18685-RC
  KO
K03099  
son of sevenless
Organism
dya  Drosophila yakuba
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE18685 (dyak_GLEANR_2470)
   04068 FoxO signaling pathway
    Dyak_GE18685 (dyak_GLEANR_2470)
   04150 mTOR signaling pathway
    Dyak_GE18685 (dyak_GLEANR_2470)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dyak_GE18685 (dyak_GLEANR_2470)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1583 aa AA seqDB search
MFSGPSGHAHTISYGGGIGLGTGGGGGGGGTQGGGGGGVGIGGGGVAGLQDCDGYDFTKC
ENAARWRGLFTPSLKKVLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEE
KVNKSFPAPIDQWALNEAKEVINSKKRKSVLPTEKVHTLLQKDVLQYKIDSSVSAFLVAV
LEYISADILKMAGDYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQ
RASATYEETVKELIHDEKQYQRDLHMIIRVFREELVKIVSDPRELEPIFSNIMDIYEVTV
TLLGSLEDVIEMSQEQSAPCVGSCFEELAEAEEFDVYKKYAYDVTSQASRDALNNLLSKP
GASSLTTAGHGFRDAVKYYLPKLLLVPICHAFVYFDYIKHLKDLSSSQDDIESFEQVQGL
LHPLHCDLEKVMASLSKERQVPVSGRVRRQLAIERTRELQMKVEHWEDKDVGQNCNEFIR
EDSLSKLGSGKRIWSERKVFLFDGLMVLCKANTKKQTPSAGATAYDYRLKEKYFMRRVDI
NDRPDSDDLKNSFELAPRMQPPIVLTAKNAQHKHDWMADLLMVITKSMLDRHLDSILQDI
ERKHPLRMPSPEIYKFAVPDSGDNIVLEERESAGVPMIKGATLCKLIERLTYHIYADPTF
VRTFLTTYRYFCSPQQLLQLLVERFNIPDPSLVYQDTGAAGAGGIGGVGGDKEHKNSHRE
DWKRYRKEYVQPVQFRVLNVLRHWVDHHFYDFEKDPMLLEKLLSFLEHVNGKSMRKWVDS
VLKIVQRKNEQEKSNKKIVYAYGHDPPPIEHHLSVPNDEITLLTLHPLELARQLTLLEFE
MYKNVKPSELVGSPWTKKDKEVKSPNLLKIMKHTTNVTRWIEKSITEAENYEERLAIMQR
AIEVMMVMLELNNFNGILSIVAAMGTASVYRLRWTFQGLPERYRKFLEECRELSDDHLKK
YQERLRSINPPCVPFFGRYLTNILHLEEGNPDLLANTELINFSKRRKVAEIIGEIQQYQN
QPYCLNEESTIRQFFEQLDPFNGLSDKQMSDYLYNESLRIEPRGCKTVPKFPRKWPHIPL
KSPGIKPRRQNQTNSSSKLSNSTSSGAAAAAASSTATTIATAAAPSLHASSIMEAPTAGA
IAGSGTLAGEQSPQHNPHAFSVFAPVIIPERNTSSWSGTPQHTRAEQNNGEVSVPAPHLP
KKPGAHVWANHSTLASSSAMDVFSPALPEHLPPQSLPDSNPFASDTEAPPSPLPKLVVSP
RHETGNRSPFHGRMQNSPTHSTASTVTLTGMSASAGEEFCPGGFYFNSAHQGQPGAVPIS
PHVNVPMATNMEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPP
RLNHSTGISYLRQSHGKSKEFVGKSSLLLPNTSSIMIRRNSAIEKRAAATTQPSAVGPIS
TTLVTVSQAVATDEPLPLPISPAASSSTTTSPLTPAMSPMSPNIPSHPVESTSSSYAHQL
RMRQQQAHPAIYSQHHHATHLPHHQHQHHSNPTQSRSSPKEFFPIATSLEGTPKLPPKPS
LSANFYNNPDKGTMFLYPSTNEE
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atgttctcggggcccagcggccatgcccacaccatcagctacgggggcgggatcggtctg
ggcaccggaggcggtggtggtggaggtggcacccagggcggcggaggcggtggtgttggc
attggtggcggtggcgtggctgggctgcaggactgcgatggctatgacttcaccaaatgc
gagaatgctgcgagatggaggggcttgtttacgccgtcgctgaagaaggtgctggagcag
gtgcatccacgggtcaccgccaaggaggacgctctgctgtatgtggagaaactctgccta
cggttgctggctatgctgtgcgccaaaccgctgccccactccgttcaggatgtggaggag
aaggtgaacaagtcctttccggcgcccatcgatcagtgggccctcaacgaggccaaggag
gtgatcaactcgaagaaacgcaagtctgtcctgcccacggaaaaggtgcacacgctgctc
cagaaggatgtgctgcagtacaagatcgacagctccgtgtccgccttcctggtggccgtg
ctggagtacatctctgcggacatactcaaaatggccggcgactatgtgatcaagatcgcc
cactgcgagattaccaaggaggacatcgaggtggtgatgaacgccgatcgcgtcctaatg
gacatgctcaaccagagtgaagcccacatcctgcccagtcccctgtcactgcccgcccag
cgagcaagtgccacctacgaggagacggtcaaggagctgatccacgacgagaagcagtac
cagcgcgacctgcacatgatcatacgcgtctttcgcgaggagttggtgaagatcgtgtcc
gatccccgggagctagaaccgatattctccaacataatggacatttacgaagtgacggtg
actctgctcggctccctggaggacgtcattgagatgtcccaggagcagagtgccccctgt
gtgggcagctgctttgaggaactggccgaggccgaggagttcgacgtgtacaagaagtac
gcctacgatgtgacctcgcaggcctcacgggatgcactcaacaatctcctgtccaaacca
ggggcctcatccctgaccacagccggccatggctttcgcgatgctgtcaagtactatttg
cccaagctgcttctggtgcccatttgccatgccttcgtgtactttgactacatcaagcac
ctcaaggatctcagctcgtcgcaggacgacatcgagagcttcgaacaggtccagggcctg
ctgcatccactccactgcgatctcgagaaggttatggccagcctgtccaaggagcgacaa
gttcccgtcagcggccgagtgcgccgccagctggccatcgagcggacgcgggagctccaa
atgaaggtcgagcactgggaggacaaggacgtgggccaaaattgcaatgaatttattcgc
gaggattcgctaagcaagcttggatcaggaaaacgaatctggagcgagcgcaaggtgttt
ctcttcgatgggctgatggtgctatgcaaggcaaacaccaaaaagcaaacaccatcggca
ggagcaacggcctacgattaccggctgaaggagaagtattttatgcgacgcgtagatatc
aacgaccgaccagacagcgatgacctgaagaacagcttcgagttggcgcccaggatgcag
ccgccaattgtgctgaccgccaagaatgcacaacacaagcacgattggatggcggacctg
ttgatggtgatcaccaagtcgatgctggacaggcacttggacagcatactgcaagacatc
gagcgaaagcacccactgcgtatgcccagcccggagatttacaagttcgcggtgcccgac
agcggtgacaatatcgtgttggaggagcgcgaaagcgcaggagtgccgatgatcaaggga
gcgacgctttgcaagctgatcgagcgcctcacctatcacatctacgccgacccgaccttc
gtgcgcaccttcctcaccacatatcgctacttctgctcaccgcagcaattgctgcagctg
ctagtggagcgcttcaacataccggatcccagcttggtctatcaagacacgggtgcagca
ggtgcgggaggcatcggcggcgttggcggtgacaaggagcacaagaactcgcatcgcgag
gactggaaacgctatcgcaaggagtatgtgcagccagtgcagtttcgagtgctcaacgtg
ctgcgccattgggtcgaccaccatttttacgatttcgagaaggatcccatgttgctggag
aagctgcttagctttctggagcacgtgaatggcaaatcgatgcgcaagtgggtggattcc
gtgcttaagattgttcaaagaaagaacgagcaggagaaaagcaataagaagattgtatac
gcctatggccacgatccgccgcccattgagcatcaccttagcgtacccaacgacgagata
acgctcctcaccctgcacccactggaactggcccgtcagctaactctgctggaattcgag
atgtacaagaatgtaaagccctcggagttggtcgggtccccctggacgaaaaaggacaag
gaggtgaagagccctaatttactgaagatcatgaagcacaccacaaacgtgacccgctgg
attgagaaatccataaccgaagcggagaattacgaggaacgccttgcaattatgcaacgc
gcaattgaagttatgatggtgatgctggaattgaacaattttaatggaatcctctcaatt
gtcgcggcaatgggcacggcatcagtttatcgactgcggtggacattccagggattgccc
gaacgctacagaaaattcttggaagaatgccgcgagcttagtgacgatcatctcaagaag
tatcaggaacgattgcgatccatcaatccgccttgtgtgccatttttcggtcgctacttg
accaacatactccacttggaggagggaaaccccgacctgctagccaacacagagctaatt
aacttttcaaaacgacggaaagtggccgagattattggcgaaattcaacagtaccagaac
cagccatactgtctcaacgaggagtccacaatacgacagttcttcgagcaactagatccg
ttcaacggactgtccgacaaacagatgtctgactatctctataacgaaagcctacgcatt
gagcccaggggttgcaagacggtgccgaaattccctcgaaagtggccgcacattccgctc
aaatcgccgggcatcaagccgcgtcggcagaatcagaccaacagcagtagcaagctgtcg
aacagcacgtcgtcaggggcggcggcagcggcagcatcgtcaacggccaccacaatagcg
actgcagcagctccatctttgcacgcatccagcataatggaagcgccaacagcaggcgca
attgctggatctggaactctcgccggcgagcaaagtccgcagcacaatccgcacgctttc
tccgttttcgcccctgttattatacccgaacggaatactagcagctggagtggaacgcca
cagcacactcgggcggaacagaacaacggggaggtttcggtgccggcgccacatctcccc
aagaaaccgggcgcgcatgtctgggctaaccactcgacattggccagttcgtcagcaatg
gatgtgttcagtccagcgctgccggagcacctgccgccgcagtccctgccggacagcaat
ccatttgcatcggacacggaagctccgccctcgccgctgcccaagctagtggtcagtccg
cgtcacgaaaccggcaatcgctcaccattccatgggcgtatgcagaacagcccaacgcat
agcactgccagcaccgtgaccctaacaggcatgtctgcatcggccggggaggagttctgt
ccgggtggcttctatttcaacagcgcccatcagggacagccgggggcagtgcccatctca
ccgcatgtcaatgttccgatggccaccaatatggagtaccgcgcagtgccgcctccactg
ccacccagacgcaaggagcgcactgagagctgtgcggacatggcgcaaaagcgacaggcg
ccagacgcacccacattacccccgcgtgatggcgaactcagtccgcccccgataccgcca
cggctcaaccattccacgggcatcagctacttgcgacagagccatggcaagagcaaggag
tttgtgggcaagagcagtctgctcctgcccaacaccagcagtattatgatacgccgcaac
tcggcgatcgagaagcgggcagcggcaactacccagccgtcggcggttggacccatcagc
acgacactagtgaccgtgtcgcaggcggtggcgacggacgaaccgctgccgctaccaatc
tcgccagcggcaagctcctcgacgaccacatcaccgctgacacccgccatgtcgccgatg
tcccccaacattcccagccatccggtggagagtacgtcgagcagctatgcccaccaactg
cgaatgcggcagcaacaggcgcatcccgcgatctactcgcaacaccatcatgctacccat
ctcccgcaccatcagcaccagcaccattcgaatccgacgcagtcccgctcgtccccgaag
gagttctttccgattgccacgagcctcgagggcacacccaaacttccaccaaaacctagt
ctaagcgctaacttctataacaatccagataaaggtacgatgtttctttacccaagtaca
aacgaagaataa

DBGET integrated database retrieval system