KEGG   Drosophila yakuba: Dyak_GE18725Help
Entry
Dyak_GE18725      CDS       T01068                                 

Definition
GE18725 gene product from transcript GE18725-RA
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dyak_GE18725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 776 aa AA seqDB search
MGQKLTCCKECGDWKWCSTQDGEEPTLRIRNANANYFTGAPQGDKTDGASSAVLGVLKVD
LCQEDNHEEHHTSHFYAATAKEALVVRRGEPFRLKIHFNRDYSPSKDAISFIFTVADDTK
PTPGHGTLNALVPHDGIDYLGDTLEWGAGIEAHEGQTLTVLIKPPSTCPVTEWKLDIDTK
LLGDGSRSFALPLPIYVLFNPWCPDDQVYLEDRDQRKEYVMHDTTLIWRGSYNRLRPSVW
KIGQFERHVLECSLKVLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGILLGNWSEDFS
GGVAPTKWTGSVEILQQFHKTQKSVKFAQCWNFSGVLTTIARCLGIPSRIITCYSSAHDT
QASLTVDVFIDANNKKLDAETTDSIWNYHVWNELWMQRPDLGVGEHGTFDGWQVVDATPQ
EASDNMYRVGPASVSAVKNGDILRPFDGGFVFAEVNADKLYWRYNGPSQPLKLLRKDTLA
IGHLISTKAVLKWEREDITDTYKHAERSEEERSTMLKALKQSRHAFSRYYLNDNFNEIEF
DMELKDDIKIGQSFSVVLKVANKSESRTHMATGQISCDAVLYTGVGAMEVKTLGFELELE
PKSSDYVRMEVIFEEYYDKLSSQAAFQISAAAKVKDTDYDYYAQDDFRVRKPDIKFQLGE
AAIVAQKELDVILRLENPLPIPLHKGLFTVEGPGIEQPLKFKIAEIPVGGTAAATFKYTP
PYAGRGTMLAKFTSRELDDVDGYRHYEIEPRPEDLLQPNGSHRSSNIIRRRTDVIA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaactaacgtgttgcaaggagtgcggcgattggaagtggtgctcaactcag
gacggcgaggagccaacgctgcgtatacgcaatgccaatgccaactatttcacgggtgct
ccgcaaggcgacaaaacagatggcgccagctcagcagtgctgggtgtgctgaaggtggat
ctgtgccaggaagacaaccacgaggagcaccacacgagccacttctacgcggcgacggcc
aaggaggcgctggtggtgaggcgtggcgagcccttcaggctgaagatccacttcaatcgg
gactacagtcccagcaaggatgccatcagcttcattttcacggtggcagatgacaccaaa
ccgactcccggccatggaacactcaatgccctggtgccgcacgatggcatcgattatctg
ggcgacactttggaatggggtgccggcattgaagcgcatgagggtcaaacgctcacggtg
ctgattaaacccccatccacctgtcccgtgacggagtggaaactggacatcgacacgaag
ctgctgggcgatggatcgcggagctttgccctgccgctgcccatctatgtgctcttcaat
ccctggtgtccggatgatcaggtgtatctggaggatcgggaccagcgcaaggagtatgta
atgcacgacaccacgctcatctggcggggatcgtacaacagattgcgtccatcggtttgg
aaaatcggtcaattcgaacggcatgtgcttgagtgcagcctgaaggtactgggcacggtg
ggcaggattccgccggcctacagaggcgatcccgtgagagttgctcgagcgttgtccgca
ctggtgaactcggtggatgatgatggtatcctgttgggcaactggtcggaggacttctcc
ggcggcgtggcacccaccaagtggacgggctcggtggagattctacagcaattccacaag
acccagaagtcggtgaagttcgcacagtgctggaatttcagcggtgttttgaccaccatt
gcgaggtgtttgggcataccctctaggatcatcacttgctactcctccgctcacgataca
caggcctcgctcaccgtggacgtattcatcgatgccaacaacaagaagttggatgcagag
accacggactccatctggaactaccatgtgtggaacgagctctggatgcagagacccgac
ttgggtgtgggcgagcacggcaccttcgatggctggcaggtggtggacgccactccgcag
gaggcatccgataacatgtaccgcgtgggacccgcatccgtttcggcggtgaaaaacggc
gacatcctgcgacccttcgatggcggcttcgtcttcgcggaggtgaatgcggataagctc
tattggcgctacaatggacccagtcagccgcttaagctgctccggaaggatacgttggcc
attggacacctgatcagcacgaaggcggtgctcaaatgggaaagggaggacatcaccgat
acctacaagcatgccgagcgctccgaggaggaaagaagcaccatgctcaaagccctcaag
caatcccggcatgcgttcagtcgttactatctgaatgacaatttcaatgagattgagttc
gatatggagctgaaggacgacatcaagatcgggcagagcttcagtgtggtactgaaggtg
gccaacaagagcgagagtcgcacccacatggccacgggtcagatcagttgcgatgccgtc
ctgtacaccggtgtgggtgccatggaggtgaagactctgggctttgaactggaactggag
cccaagagcagcgactatgtgcgcatggaggtgatcttcgaggagtactacgacaagctg
tcctcgcaggccgccttccagatatcggccgccgccaaggtcaaggacaccgactacgat
tactatgcgcaggatgatttccgggtgcgcaagccggacattaagttccagctgggtgag
gctgccattgtggcccaaaaggagctggacgttattctgcgcctggagaacccactgccc
attccactgcacaagggtctgttcaccgtggagggtcctggcatcgagcagcctctcaag
ttcaagatcgccgaaattccagtgggaggcactgcggctgccaccttcaagtacacgccg
ccctacgcggggcgtggcaccatgctggccaagttcacgtccagggaactggacgatgtg
gatggctacaggcactacgaaatcgagccacggccggaggatctgctgcagcccaatgga
agccatcgaagcagcaacatcatccgcagacgcaccgatgtaattgcctaa

DBGET integrated database retrieval system