KEGG   Drosophila yakuba: Dyak_GE18820Help
Entry
Dyak_GE18820      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
dya  Drosophila yakuba
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dyak_GE18820
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dyak_GE18820
Peptidases [BR:dya01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Dyak_GE18820
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE18820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 267 aa AA seqDB search
MRPSIGLTGMAKTILQLFLGGILLVSLSLGATVRRPRLDGRIVGGQVASIKDIPYQVSLQ
RSYHFCGGSLIAQGWVLTAAHCTEGSAILSSKVRIGSSRTSVGGQLVGIKRVHRHPKFDA
YTIDFDFSLLELEEYSAKNVTQAFVGLPDQDADIADGTPVLVSGWGNTQSAQETSAILRS
VTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAADGVLWGVVSWGY
GCARPNYPGVYSRVSAVRDWIGSVSGI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgagcattggattgaccggcatggcaaagacgattcttcagctctttctcggc
gggattctcctggtaagcctcagcttaggcgccaccgtgaggcgccctcgcctggatgga
cgcattgtgggcggccaggtggctagcataaaggacattccctaccaggtttccctgcag
cgtagctatcacttctgtggcggctccctgatcgctcagggctgggtactcacagctgcc
cactgcactgaaggatcggccatactctcatccaaggttcgaattggatcctctcggacg
tctgtaggcggtcaattggtggggatcaagcgagtccatcgacatcccaaattcgatgcc
tacaccatcgactttgacttttcgctcctcgagcttgaggaatatagtgccaagaacgtg
acgcaggctttcgtagggctgcccgaccaggatgcggacattgccgatggtactccggtc
ctggtttccggctggggaaacacgcagagcgcccaggagacctcagccatcctgcggtcc
gttacggtgcccaaagtcagtcagacgcagtgcacagaggcgtatggcaactttggcagc
atcacggatcgcatgctctgcgccggattgccggagggcggcaaggacgcctgtcaaggg
gactcaggaggtcctctggctgctgatggtgtcctttggggcgtggtctcttggggctac
ggctgtgccaggccaaactatcccggcgtttactcgcgcgtctctgcggttcgtgattgg
attggctccgttagtggcatctga

DBGET integrated database retrieval system