KEGG   Drosophila yakuba: Dyak_GE18902Help
Entry
Dyak_GE18902      CDS       T01068                                 

Definition
GE18902 gene product from transcript GE18902-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dyak_GE18902
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dyak_GE18902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 1027 aa AA seqDB search
MACFPRLFHHRSKNKFTPAEDENTDTILNTQDSAVQIGRYIRREEKPLYSPIVTPSASEA
KLQRLRQQPPGSPSAPASTSASASARWTLQSVAENGSANNGVQERKFRTNKDKLPTQDAI
NVTRSSSKLKPVKERRPTALPTEVPSIEIQDVQDALDARDGQDSLEEGVVALQPGANAHV
DVVDGGKSKLKVNVNGIIDEGVAHDDDEEDDDDVATPSSTCTATTPVTGGPVKFFIGHTQ
ELSAQQTDDTLSWQSSDANNNSSSSSAAKLTNGVLPQEQQEREQEKDRKQDSSRGNLQPP
RAKSSSNLSLNYLAKSQTDSQRRRRVSTMPDINIPPAPPLPPELLVPGTPLHLRKKRSVE
RPQQEQQQQQQQQEQGNQKSQQDASNSQDQIAGAEEGGESQKSSDSSTPKTHRVEGGLIY
VRPNFPTQGDIEIESIAKDEGTRNLIRTAIERNDFLNNLMDKERKEMVINAMAPASYRKH
SLIIREHEEGSEIYVSAEGQYDVIRGGQLVASFGPATVFGELAILYNAPRQASIEAATDA
RVWKIARETFRAIMQISGSREREENLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSC
IVREGELGNEFYIIRCGTVTIKKRDDQQQEQIVANRKRGDYFGEQALLNADVRQASVYAD
APGTEVLMLDREAFISYLGTIKQLREKPSSQRSDTSGRSSNKSLEFDNEYSQVAISELKK
IATLGCGAFGRVDLVAYNQQALALKIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQL
YRTYRNDKYVYFLMEACMGGDVWTVMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRD
LKPENLMLGTDGYCKLVDFGFAKFVRHNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWAL
GILVYELLVGKTPFRGVNQIKIYQQILSGIDVIHMPARIPRSAQHLVRHLCKQLPAERLG
YQRKGIADIKRHSWFESLDWQRLKQKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEEL
SGWDKDF
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccccgacttttccatcatcgcagcaaaaacaaattcacgcccgccgaa
gatgagaacaccgatacgatactcaacacacaagatagtgccgtgcaaattggcaggtac
atccgtcgcgaggagaagccactgtactcgcccatcgtcactccaagtgccagtgaggcc
aaacttcagcgcctcagacagcagccgcccggctcaccgtccgcccccgcctccacctcc
gcctccgcatccgccaggtggaccctgcagtcggttgccgaaaatggcagcgcaaacaat
ggcgtccaggagcgcaagttccgcaccaacaaggacaaactgccgacgcaggatgcaatt
aatgtcacacgctcaagttcgaaattaaaaccagtcaaagagcgtcggcccaccgccctg
cccaccgaggtgcccagcatcgagatccaggatgtgcaggatgcactggatgcaagggat
ggccaggactcactggaggagggggtggtggcgctgcagccgggtgctaatgcacatgtc
gatgtcgtcgatggcggcaagtcaaaactcaaagtgaatgtgaatggcataattgatgag
ggcgtcgcccacgacgacgatgaggaagacgacgatgatgtcgccacaccctcgagcacc
tgcacagccacgacacctgtgaccggaggtcctgtaaagtttttcattggtcacacgcag
gaactaagcgcccagcaaacggatgacaccttgtcctggcagagcagcgatgccaacaac
aacagcagcagcagcagcgccgccaagctgacaaatggcgtcctgccacaggagcaacag
gaacgggaacaggaaaaggacaggaaacaggactcctccagaggtaacctgcaaccaccg
cgcgccaagagctccagcaacctgtcactcaattatctggccaaaagccagacggatagc
cagcgccgccgacgtgtgtccacgatgcccgatattaacataccgccggcaccgccactg
cctccggagctcctcgtccccggaacgccgctccatctgcgcaagaaacggagcgtggag
cgaccgcagcaggagcagcagcagcagcagcagcagcaggagcagggaaaccagaagagc
cagcaggatgcttcgaatagtcaagatcaaatagcaggagcagaggagggcggcgagagt
cagaagtccagcgattcctcgacaccgaaaacccatcgcgtggaaggtggcctcatctat
gtgcgtcccaattttcccacacagggcgacattgaaatcgaatctattgcaaaggacgaa
ggcacacgcaatctcatacgaacggccattgagcgcaatgatttcctcaataatctaatg
gacaaggagcgcaaggagatggttatcaatgccatggccccggccagctacaggaagcac
agcctcatcatccgggagcacgaggagggctccgagatctatgtctccgccgagggccag
tacgatgtcatccgtggtggccaactggtggccagctttggaccggccaccgtcttcggt
gaactggccatcctctacaatgctccgcgccaggcgtccatagaggctgccaccgatgca
cgggtttggaaaattgcacgcgaaaccttcagggccatcatgcaaatctctgggtccagg
gaacgcgaggagaacctccagttcctgcgctccgctccctttctgcaggagttcgaccag
agtttgctgctcaaagtcgtggatcttctgcagcggaaattctacgagaccgacagctgc
attgtccgcgaaggagagctgggcaacgagttctacatcatccggtgcggcacggtgacc
atcaagaagcgggacgaccagcagcaggagcagattgtggccaatcgaaagcgcggcgac
tacttcggggagcaggcgctgctcaatgcggatgtgcggcaggccagtgtctatgcggat
gccccgggcaccgaggtgctcatgctggacagagaagccttcattagctatctgggaacc
ataaagcagctgcgcgagaagcccagcagtcagcgcagcgatacgagtggtcgctccagc
aacaagtccctggagttcgacaacgagtactcccaggtggccatctcggagctgaagaag
atagccacgctgggatgcggcgcctttgggcgagtggatctggtggcctacaaccaacag
gcgttggccctgaagatcatcaagaagatcgaggtggtcaagcaggatcaaatcgagcac
gtttacaatgagaagaacgttatgatcaagtgccgtcaatcgcccttcatagtacaactg
tatcgcacgtaccgcaatgacaagtacgtctacttcctaatggaggcgtgcatgggcggt
gatgtatggacggtgatgtcaaagcgccagtacttcgatgagaagacggctaaatttata
gcgggctgtgtcgtcgaggccttcgactacttgcactcccaccacttcatctacagggac
ttgaagcccgagaacctgatgctgggcacggatggctattgcaaactggtcgatttcggg
tttgccaagtttgtgcggcacaatgagaagaccaacacatttgcgggcacaccggagtac
gtggccccggagataattctggatcgtggacacgatcgagccgtcgactattgggcactg
ggcattctcgtatatgaactactggtgggcaaaacccccttcaggggcgtcaaccagatc
aagatctaccagcaaatcctcagtggcatcgatgtcatccacatgccggcgcgcataccc
aggtccgcgcagcacctggtgcggcatctctgcaagcaactgccggcggagaggctgggt
tatcagcgcaagggaatcgcggatatcaaacggcatagttggttcgaaagcctcgactgg
cagagattgaagcagaagcaactgccgtcccccatcaagagacctttgaagagttggacc
gacttgcagtactttggtccttcgggtgttgagaacgactatgagccaccggaggaactg
agcggttgggataaagacttttag

DBGET integrated database retrieval system