KEGG   Drosophila yakuba: Dyak_GE18961Help
Entry
Dyak_GE18961      CDS       T01068                                 

Definition
GE18961 gene product from transcript GE18961-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dya  Drosophila yakuba
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dyak_GE18961
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dyak_GE18961
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dyak_GE18961
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dyak_GE18961
   00511 Other glycan degradation
    Dyak_GE18961
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE18961
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dyak_GE18961
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE18961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 672 aa AA seqDB search
MNGCRGNRKLTMAVSGCLIIAVMALTVGLCVGLGGGTEALEDQPRFAIDHEANTFMLDGQ
PFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNWEGIADVVK
FLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFAKYPSIKMRTNDPNYISEVGKWYAEL
MPRLQHLFVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEK
MSCGKIENVFATTDFGIDRINEIDKIWAMLRALQPTGPLVNSEFYPGWLTHWQEQNQRRD
GQEVANALRTILSYNASVNLYMFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDE
AGGVTTKYDLVKAVIGEFLPLPEITLNPAKRLAYGRVELTPKLALLSTEGRTALSKGSPV
ESIKPKTFEELDLYSGLVLYETELPSMDLDPALLKVDQINDRAHVFVDQELVGTLSREAQ
IYSLPLSKGWGSTLQLLVENQGRVNFYISNDTKGIFGEVSLQLHNGGYLPLENWRSTAFP
LEQSAIELWRREHSDQKALDTLLARQRILRNGPILYTGSLAVTEVGDTYLNMAGWGKGVA
YVNGFNLGRYWPVAGPQVTLYVPNEILQVGENSLVILEYQRANKTATGEDLPAVQFDAVA
QLDGESGDAPLK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctgtcgcggcaatcgaaagctgacaatggccgtaagtggatgtctgataatt
gcagtgatggccctcaccgttgggctctgcgtgggactgggcggtggcaccgaagccctc
gaggaccagccaaggtttgcgatcgaccatgaggccaacacgttcatgctggatggccag
cccttccgctacgtctctggatcgttccactacttccgcgctgtgcccgagtcctggcga
agtcggttgcgcaccatgcgggcatctggtctcaatgctctggatacctatgtggaatgg
tcgctacacaatccccacgatggagaatacaactgggagggcattgcggatgtggtgaag
tttctggagattgctcaggaagaagacttctacattattctccggccaggtccctacatt
tgtgctgagcgagataatggtggtcttccccactggttgtttgccaaatacccgtccatc
aagatgcggaccaacgaccccaactacatctcagaggtgggcaagtggtatgcggagttg
atgccacgcctccagcacctgttcgtgggcaacggcggcaagatcataatggtgcaggtg
gagaacgagtacggggactatgcctgcgatcacgactacctcaactggctgcgagacgag
acggagaagtatgtgtccggcaaggcgctgctcttcacggtggacatacccaacgagaag
atgagctgtggcaaaatcgagaacgtgttcgccaccactgacttcggcatcgatcgcatc
aatgagattgacaaaatctgggcaatgctgcgtgccctgcagcccactggtccactggtt
aactcggagttctatcccggctggctaacccattggcaggagcagaaccaaaggcgtgat
ggccaggaggtggccaatgcgttaaggacaattctgagctacaacgccagtgttaacctc
tatatgttcttcggcggcacaaacttcggcttcactgctggtgccaactacaacctggac
ggaggcatcggatatgcggcggacattaccagttacgactacgatgcggtgatggacgag
gccggtggcgtcaccacgaagtacgacctggtcaaggctgtgattggagagttccttccg
ctgcctgaaatcaccttgaatcccgctaagcgcctggcctacggaagggtggaactcacg
cccaagttggcactgctctctacggaaggacgaacggcgctctccaagggaagtcccgtc
gaatcgatcaagcccaaaaccttcgaggaactggacttgtactcgggtctcgtcctctac
gagaccgagctgccaagcatggatctagacccagccttactgaaagtggatcaaattaac
gaccgcgcacacgtattcgtagaccaggaactggtgggcacactctcccgcgaggcccag
atctactcgctgccgcttagcaagggatggggcagcacactgcaactgctggtggagaac
caaggacgcgtcaacttctacatctccaacgacacgaagggcatctttggcgaggtgagc
ctccagctgcacaacggtggctacctcccactggagaactggcgcagtaccgctttcccc
ctggagcaatccgccatcgagctctggcgccgcgaacacagcgaccagaaggccttggac
acgctgctggcaaggcaacgcattcttcgaaacggacccatcctctacactggcagcttg
gcagtgacggaggtgggcgacacctatttgaacatggccggttggggcaagggcgtggcc
tacgtcaacggcttcaatctgggacgctactggcctgtggcaggtccacaggtcactttg
tacgtgcccaacgaaatccttcaagtgggcgagaactcgctggtcatccttgagtaccaa
cgtgcgaataagacagcaacaggcgaggatctgcctgcggtgcagtttgatgcagttgcc
cagctggacggagagtcaggtgatgctccacttaaataa

DBGET integrated database retrieval system