KEGG   Drosophila yakuba: Dyak_GE18963Help
Entry
Dyak_GE18963      CDS       T01068                                 

Gene name
dyak_GLEANR_2745
Definition
(RefSeq) GE18963 gene product from transcript GE18963-RB
  KO
K05759  
profilin
Organism
dya  Drosophila yakuba
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE18963 (dyak_GLEANR_2745)
Membrane trafficking [BR:dya04131]
 Others
  Actin-binding proteins
   Others
    Dyak_GE18963 (dyak_GLEANR_2745)
Cytoskeleton proteins [BR:dya04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dyak_GE18963 (dyak_GLEANR_2745)
Exosome [BR:dya04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dyak_GE18963 (dyak_GLEANR_2745)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSNGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgatggcaacatttgggcgcagtccaatggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggcttcgatcagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctctccggcacagaccgcgtggtgcgcgcc
aagctcggcaggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagccccagcaggccgcttccgtcgtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system