KEGG   Drosophila yakuba: Dyak_GE19029Help
Entry
Dyak_GE19029      CDS       T01068                                 

Definition
GE19029 gene product from transcript GE19029-RA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dya  Drosophila yakuba
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dyak_GE19029
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dyak_GE19029
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dyak_GE19029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 947 aa AA seqDB search
MAEPLGVETKPLSNGNANGNAVGIAESASAVFQEKMKLQMEEPSEITAVPKYGLKLKFDH
VWPEKRIQNVRASIRQTLPMVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPIG
GIGGGTIGRGYAGEFCRFQMRPGIYEYNVVQANQFIVTIKDPKGCTIFQSLLSKCSTRDK
SSDPDADPDGERTKCQLPNCSSRAKQPLSAWHSNIEDSRCSYTGLYPRSWTEYDLSHYGV
RLTCRQVSPVIPHEYRDSSLPCAVFVWSVENVCDQERKVSITFSFKNGTGNKKQDAEGGA
ESQLISEGNAKGVSIRQKIAEMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKEH
GQLSEQPTSEALKTKDIGVAVCAQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYYT
KYFDASGDSGPKICEYALRQYSTWERLIDAWQRPILNDESLPDWYKCAIFNQLYFISDGG
TIWLKCDSSLGKELTYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQVS
LQYDFKDAIAAELSDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVNDW
KDLNTKFVLQVYRDYYVLNELAQAQADNASKFSSIEFIDKESLYELYSQDNKRKNSTDEK
QQNRKSASMYINETNGKVYLMDAIGYLKAMYAPCKAIMERTIEYDKDNDGLIENTKMPDQ
TYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLWNGS
YYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGNI
GAANGFIANAGEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYKT
LSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRAQRD
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacctttaggagtggaaaccaagccgctgagcaatggaaacgccaatggaaac
gcggtgggaatcgccgagtccgccagtgccgtcttccaggagaagatgaagctgcagatg
gaggagcccagcgagatcacggcggtgccgaagtacggcctcaaactgaagttcgaccat
gtgtggccggaaaagaggatccagaatgtgcgggcctccatcaggcaaacgctgcccatg
gtgcccctcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgtcgg
gtgtacatggactactactacatggagaacggcaagcagatctatggagtgcccatcgga
ggaattggcggcggcaccattggaaggggctatgccggcgagttctgccgattccagatg
cgtcccggcatctacgagtacaacgtggtgcaggccaatcagttcatcgttaccatcaag
gatcccaagggatgcaccatctttcagagtctcctctccaagtgcagcaccagggacaag
tccagcgatccggatgccgatccggatggggaaagaactaaatgtcaactgcccaattgc
agcagtcgcgccaagcagccgctgagtgcctggcactcgaacatcgaggactcgcgctgc
agctacacgggcctctatcctcgctcctggacggagtacgatctgtcccactatggagtg
cgtttgacctgtcgccaggtatcgccggtgatcccacacgagtaccgggactccagtctg
ccctgcgccgttttcgtatggagcgtggagaatgtctgcgaccaggagcgcaaggtgtcc
attacgttcagttttaagaacggcacagggaacaagaaacaggatgcggagggcggagca
gagtcgcagctaatcagcgagggcaacgccaagggagtctccattcggcagaagatcgct
gagatgccctgcagctataacctggcatgtagagtccttcccgagatcagcatcacgcgg
tgtccccagttcgatcccgccggcaacggagagcagctgtgggcacagctcaaggagcac
ggccagcttagcgagcagcccacctcagaggcactaaaaaccaaagatataggcgtcgct
gtctgtgcccaggtggctctgaagccaatggcgtcccacgatctggagtttgtgctggcc
tgggacatgccaaagattcagttccccaggaagatgcagacccacacgcgctactacacc
aagtacttcgatgccagcggagattcgggtcccaagatctgcgagtatgccctaaggcag
tattccacctgggagcggttgatcgatgcctggcaaagacccattctcaatgatgagagc
cttcccgactggtacaagtgcgccatattcaatcaactttacttcatctcggatggcgga
accatctggttgaaatgcgattcatcgctgggcaaggaactgacatatgatgatccgcgg
ctggcctatggccgtttcggttacctagaaggccacgaataccgcatgtacaacacctac
gatgtccacttctatgcatcaccagctctggctcacctgtggcccaatcttcaggtcagt
ctgcagtacgacttcaaggatgctatagccgcagaactgagcgatacccgtaaaatgctt
tacgatggcaaggtgatgccgcgcaaggtcaagaattgtgtgccccacgatctcggggat
cccgatgaggaacccttcaccctgatcaactgctacaacattcacgatgtgaatgattgg
aaggatctcaatacgaagtttgtgctgcaggtctaccgggactactatgtcctcaatgaa
ctggcccaggcccaggcggataatgccagcaagttcagctccatcgagttcattgataag
gagagcctgtatgagctgtacagccaggacaacaagcgcaagaattctacagatgaaaag
caacaaaaccgcaaatctgcatcgatgtacatcaacgaaacgaatggaaaggtgtatctc
atggacgccattggctatttgaaggccatgtacgcaccgtgcaaggccatcatggagcgg
accatcgagtacgataaagacaacgacggtctgatcgagaacacgaagatgccggaccaa
acctacgactcctgggtgatggacgggccaagtgcctactgctccggtctctggctggct
gctctgcaagccatgtccgccatggctacaattctggaccagccgaacgattgcctgcgc
tatcaggatattctggagaagggcaagcgatcgctggaggagaagctctggaacggcagc
tactatcgctttgatctatctcacagtcaccgggatacgattatggcggatcagctgtgc
ggtcattggtatctaaagtcctgcggcttcgactacgagatctatccgaaggaaaatgtg
cgtactgcccttaagcggatctacgacaacaatgtgatgggctttcatgagggcaatatc
ggagcggccaatggcttcatagccaacgccggcgaacccaccaagccgggtcacgtggac
aacagcaacatccaggcagaggaggtgtggccaggggttgtgtacgctctggcagccacc
atgatacaggagggcatgttcgaggaagccttccagaccgccggcggaatgtacaagacc
ctgtcgcagcgcatcggcatgaacttcgagaccccggaagctttgtacggagaaaagcgc
tatcgctccattggctatatgcgccccttaagtatttggtccatgcaggtggcattggag
cgacggcgagcccaacgcgattaa

DBGET integrated database retrieval system