KEGG   Drosophila yakuba: Dyak_GE19277Help
Entry
Dyak_GE19277      CDS       T01068                                 

Gene name
dyak_GLEANR_3050
Definition
(RefSeq) GE19277 gene product from transcript GE19277-RB
  KO
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     Dyak_GE19277 (dyak_GLEANR_3050)
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   Dyak_GE19277 (dyak_GLEANR_3050)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 422 aa AA seqDB search
MRLFPVRFSAASSSMASLAKMLDFYSGFNPSPLSIKQFMDFGQNACEKKSYIFLRKELPV
RLANIMKEIALLPDNLLHTRSVSEVSSWYVKSFEDVLVYEKAEPTHDNLQKFVADLDLIR
NRHNDVVQTMAQGVIEMKENEGGQVDAPTESSIQYFLDRLYMSRISIRMLINQHTLLFGG
NPHAGGRHIGCLDPACDLSDVVRDAYENARFLCDQYYLSSPALEIQQHSSEPGDNLPIRT
VYVPSHLYYMLFELFKNSMRAVVEHHGHDNNDTLPPLKVAICKGKEDICVKISDQGGGIP
RSQSDQLFKYMYSTAPQPSKSDLHTVPLAGYGYGLPISRLYARYFHGDIVLLSCEGFGTD
AIIYLKALSDEANELLPIFNKTSSKFYRATVPTGDWSNQSSDMNARQLSATTPKRCDFLQ
DA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgtttccagtccgattctcagccgcctcctcgtcgatggcgagtttggccaaa
atgctcgacttctactcgggcttcaacccatcgcccctctcgataaagcagttcatggat
tttggtcaaaatgcttgcgagaagaaatcttacatattcctacgcaaggagctcccggtt
cggctagcgaatatcatgaaggagatcgcccttctgcctgataacctgttgcacactaga
tccgtaagcgaagtaagttcttggtatgttaaaagtttcgaggatgtgctggtgtacgag
aaagctgagcccacccacgacaatctgcaaaagtttgtggccgatttggatctcattaga
aatcggcacaacgatgtagtgcaaaccatggcccagggtgtgatcgaaatgaaggagaac
gagggcggtcaggtggatgcgcccacagagagttccattcagtactttctcgacaggctc
tacatgtcccgcatcagcattcgaatgctgattaatcagcacacccttctctttggcgga
aatccccatgcgggtggccgccacattggttgcttggatcccgcctgtgatctgtcggat
gtggttcgcgatgcctacgagaatgctcgattcctgtgcgatcagtactacctgtctagt
ccggcgctggagatccagcagcacagcagcgagcctggagacaacctgcccatccgcacg
gtgtacgtgccctcgcacctatactacatgcttttcgagctcttcaagaactcaatgcgt
gctgttgtggagcaccatggccatgacaacaatgacacattgccccccttgaaagtagcc
atttgcaagggcaaggaggacatctgcgtgaaaatttctgaccagggtggcggtattccc
cgttcccagagcgatcagctcttcaagtacatgtacagtacagcgccgcagccctcgaag
tcggatctgcatacggtgcccttagcgggctacggatacggtctaccgatctcaaggctt
tacgcccgctatttccacggcgacattgtgctactctcctgcgaaggattcggcaccgat
gcaattatatatctaaaggctctgtccgacgaagcaaacgaattgctgccgatcttcaac
aagacaagctcaaagttctatcgcgccaccgtgcccacgggtgactggtccaatcagagc
tctgatatgaacgcacgccagctgtcggccaccacacccaaacgttgcgactttcttcag
gacgcatga

DBGET integrated database retrieval system