KEGG   Drosophila yakuba: Dyak_GE19286Help
Entry
Dyak_GE19286      CDS       T01068                                 

Definition
GE19286 gene product from transcript GE19286-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dya  Drosophila yakuba
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dyak_GE19286
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dyak_GE19286
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE19286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 515 aa AA seqDB search
MARIFILVLVIAVCLSGSVSGQRDHPRGRSFDAESHPIKHAEEQQTQYWVDKAQEKLLTK
LAEEQFATKNKAKNVIMFLGDGMSVHTVTATRNLLGDSAEQVYFEGFPYTGLSKTYCVNR
QVADSACTATAYLGGVKANYGTIGVNANVSRYSCDGAANEEDRVLSIAQWAQAAGKDAGL
VTTARVTHASPAGVYAHIADRNWENDWEVANGKCDPEQTIDIARQLVEQPVGQQLKVILG
GGRKNFISTTVNDEEGYPGKRTDGRHLIRSWLDQKREANVSAHYVWSRKGLSLVDLESTD
YLLGLFANDHLPYNGDRDRKRSQLADPSLTELTEAAIKVLSRNEKGFFLFVEGARIDMAH
HDTFARRSLEDTAEFARAVQKARELTSEDDTLIVVTADHAHVMSINGYPYRDQEITGLAQ
LADDNLPYTILSYANGPGYYSGYNRAEGRALLKEKLVADTDYQYPTLAPLDAETHGGDDV
AVYASGPYAQYFSGNYEQSNIPALMARAAGIGPFA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatattcattcttgtcctcgtcatagctgtctgcctgagcggaagtgtcagc
ggccaaagagaccaccctcgagggcgatccttcgatgccgaatcgcatcccatcaagcat
gcagaggaacagcagacccagtattgggtggacaaggcccaggagaagctattaacgaaa
ctggccgaggagcagttcgcgaccaaaaacaaggcaaagaacgtcattatgttcctgggc
gacggaatgtccgttcacacggtcacggccacccggaacctgctgggcgacagtgcggag
caggtgtacttcgagggatttccctacactggcttgtccaagacctattgcgtgaaccgc
caggtggccgattccgcttgcacggccactgcctatttgggtggagtgaaggcgaactat
ggaaccattggcgtgaacgccaatgtgtccaggtacagctgtgatggcgccgcaaacgag
gaggatcgggtgctcagcatagcccagtgggcacaggcggctggcaaggatgcagggctg
gtcactacagccagggtgactcacgcatcgccggccggcgtttatgcccacatcgccgat
cgcaattgggagaacgactgggaggtggccaacgggaagtgcgatcccgagcagaccatc
gatattgcccgccagctcgtggagcagcctgtgggtcagcagctgaaggtcatccttggg
ggcgggcgcaagaacttcatcagcactacggtgaacgatgaagagggatatcctgggaaa
cgtaccgacggtcgccacttaatccgcagctggttggatcagaaaagggaggccaatgtc
tcagcccattacgtctggagtcgcaagggactcagtctggtggatctcgagagcacggac
tatctcttgggtctctttgccaacgaccacctgccgtacaacggtgatcgggacaggaaa
cgtagtcagttggcggatccttcgctgactgagctcacggaggccgccatcaaggttttg
agtcgtaatgaaaaggggtttttcctcttcgtcgagggtgctcgtatcgacatggcccac
cacgatacctttgccaggagatccctcgaggataccgccgagtttgcgagggcggtgcag
aaggcacgcgaacttacctccgaggatgacacactaatcgttgtgaccgccgaccatgct
catgttatgtccatcaatggttatccttatcgtgaccaggagattaccgggttggctcag
ctggcggatgacaatctgccctatacgattttgtcctatgccaatggacctggctactac
tcaggatacaatcgtgctgagggacgtgcccttctaaaggaaaagctggtggcggacaca
gactatcagtatcccacgctggcgcccttggatgcggaaactcacggaggagacgatgtg
gcggtgtacgcctcgggaccctatgcccagtacttcagtggcaactacgagcagagcaat
attccggctttgatggcgagagcagcgggtatcgggccctttgcctag

DBGET integrated database retrieval system