KEGG   Drosophila yakuba: Dyak_GE19320Help
Entry
Dyak_GE19320      CDS       T01068                                 

Definition
GE19320 gene product from transcript GE19320-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dya  Drosophila yakuba
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dya03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 236 aa AA seqDB search
MADDWESAADSEVVIRPTGAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKP
KPNKALKAKLEQQARLEEEAEAQRVANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTS
TCGGLDAFNPESKEEFKEFGATLSWKVSQFRESEHFPQFVEDLVRSLCVNLSAADIKKVK
MNVEILHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgattgggaatccgcagcagacagcgaggtggtcatccggccgactggtgcc
gccagcgtaaacaagtgggagggcgaggacgaggatgaggacatcaaggacagctgggag
gacgaggaggagaaaaaggacgaggagaagcccacgaaaacagaagccccagccaaaccg
aagccaaataaggcgctaaaagccaaactggaacagcaggcgcgcctagaggaggaagcg
gaggcacaacgtgtggccaacctatcgcctgcagaaaagttggctgagaagctgcgattg
caaaaaatccaggaggcctctgatctcaagcatgctcaggaggcgtttggcgtgacgagt
acgtgcggaggcctagacgccttcaacccggagagcaaggaggagttcaaggagttcggc
gcaacgctcagctggaaggtgtcgcagttccgcgagtcggagcacttcccccagttcgtt
gaggatctggtgcgcagtctatgcgtgaatctgagcgccgctgacatcaaaaaggtcaag
atgaacgtggaaatcttgcactcggaaaagctgaagctggaaaaggccaatgccaagaag
cccgctggaaaaggcaagggcaaggtcactctccgcaccgaaaacgacgatattgacggt
taccaaaagtacggaaatgacttcaccgaggactatgacgacttcatgtga

DBGET integrated database retrieval system