KEGG   Drosophila yakuba: Dyak_GE19339Help
Entry
Dyak_GE19339      CDS       T01068                                 

Gene name
Dyak_Pfk, Pfk, dyak_GLEANR_3112
Definition
(RefSeq) GE19339 gene product from transcript GE19339-RC
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dyak_GE19339 (Dyak_Pfk)
   01230 Biosynthesis of amino acids
    Dyak_GE19339 (Dyak_Pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE19339 (Dyak_Pfk)
   00030 Pentose phosphate pathway
    Dyak_GE19339 (Dyak_Pfk)
   00051 Fructose and mannose metabolism
    Dyak_GE19339 (Dyak_Pfk)
   00052 Galactose metabolism
    Dyak_GE19339 (Dyak_Pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dyak_GE19339 (Dyak_Pfk)
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dyak_GE19339 (Dyak_Pfk)
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dyak_GE19339 (Dyak_Pfk)
Messenger RNA biogenesis [BR:dya03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dyak_GE19339 (Dyak_Pfk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 952 aa AA seqDB search
MHSIKFRVFTKLNPLFLEINGRIQQCRRFHGPTIFRLGNSTKTLPIRPKLTCLSIDIQCT
RSHHLYSPQDISHRENALLNVKFNWIRHFIKSYSYCSDQKNDSPSDKNIKDDKPAQRCGR
PLSNVHNGFLNADNYSEKSVRKKKKSFPKKEGAKSLEELRKCLRTMQDVLDFVHPVKPFK
DKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGMVDGGDCIQEANWASVS
SIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSS
LLNELVANKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISS
TAYSHQRTFIMEVMGRHCGYLALVGGLACEADFIFIPEMPPKVDWPDRLCSQLAQERSAG
QRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGHVQRGGNPSAFDRILAC
RMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAVAKAMAEKRWADAVKLR
GRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAI
YRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKE
FKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLGCDTGLN
EITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAYIYEEKFSIKDLQQ
DVYHMASKMAEGVSRGLILRNEKASENYSTDFIYRLYSEEGKGLFTCRMNILGHMQQGGS
PTPFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDL
IAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVA
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaataaaatttcgagtatttaccaaattaaatcccttatttttggaaattaat
ggacggatacaacaatgccgtcgttttcatggacctacaatatttcgcttaggaaactca
accaaaacacttccgattaggccaaagctgacttgtctaagcatcgatatccaatgcaca
cgaagtcatcatttgtatagtcctcaagatatttcgcatagagaaaatgctcttttaaat
gtaaaatttaattggattcgacattttataaagtcgtacagttattgtagtgatcaaaag
aatgatagtcctagcgataaaaacataaaagatgacaaacctgcgcaacgatgtggaaga
ccattaagtaatgtgcacaatgggtttctcaatgctgataactattctgaaaaaagtgtt
agaaaaaagaaaaagagctttccaaaaaaggaaggtgccaaatcgctagaagagctgcga
aagtgtttgagaaccatgcaggatgttttagattttgtgcatccggtcaagccttttaag
gacaaaggactggcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtc
cgagcctgtgtgcgtatggccatctatttgggctgcaaggtctacttcatacgtgaaggc
taccagggcatggtagatggaggcgactgcatccaggaagccaactgggcctcagtctcg
tccatcatccatcgtggtggtacgatcattggctccgcccgttgccaggacttccgtgag
cgtcagggtcgcttgaaagccgccaacaacctgatccagcggggaatcaccaatctggtg
gtcattggaggcgatggctctcttaccggcgccaatctgttccgtcaggagtggtccagc
ctgctgaacgagctggtcgctaacaagaccattaccaccgagcagcaggagaagttcaat
gtcctgcatatcgttggattggtgggctctatcgacaacgatttctgtggcacggacatg
accatcggaacggacacggctctgcatcgcattattgaggccatcgatgccatttccagt
accgcctactcccatcagcgcaccttcatcatggaggtcatgggtcgtcattgcggctat
ttagctcttgtgggcggactggcgtgcgaggcggatttcatattcattcccgaaatgccg
cccaaggtcgattggccagacaggctctgctctcagctggcccaggagcgatctgctggc
cagcgcctgaacatcgtgatcgtcgctgaaggagccatggatcgcgagggtcatcccatt
acagccgaggatgtgaagaaggtgatcgacgagcgcttgaagcacgatgcccgcatcact
gtcttgggtcacgtgcagcgcggtggcaatcccagtgccttcgaccgtattttggcttgt
cgcatgggagctgaagccactttggccctgatggaggccaccaaggactcggtgccagtg
gtcatctctctagacggcaaccaggcggttcgcgtgccgctgatggagtgcgtcgagcgc
acccaggctgtggccaaggccatggcggagaaacgctgggcggatgccgtcaagctgcgc
ggacgctccttcgagcggaatctggagacctacaagatgctgacgcgcttgaagcctccc
aaggagaacttcgacgccgatggtaagggaatcgaaggataccgcctagctgtgatgcac
attggtgctccagcttgcggtatgaatgccgctgtgcgcagcttcgtgcgaaatgccatc
taccgcggtgatgtggtttatggaatcaatgacggtgtcgagggtttgatagccggaaat
gtccgcgagctgggctggtccgatgtctcaggatgggttggtcagggtggcgcctacttg
ggcaccaaacgcactctgcctgagggtaagttcaaggagatcgccgctcgtctcaaggag
tttaagatccagggtctcctgatcatcggtggctttgagagttaccatgccgccggacag
atcgccgatcagcgggacaactacccacagttctgcatccccattgtggttattccatcg
acgatctcaaacaatgtgcctggcacagaattttctctgggatgcgacaccggtttaaat
gaaattacggagatttgcgaccgtattcgtcagtcggcccagggcaccaagcgtcgagtg
tttgtcatcgagacgatggggggctactgtggctatttggccactttggccggtttggcc
ggcggagctgatgccgcctacatctacgaggaaaagttctccatcaaggacctgcagcag
gatgtctaccacatggcttcaaagatggccgagggcgtctcccgtggtctgatcctgcga
aacgagaaggctagcgaaaactacagcacggacttcatttaccgcctgtactctgaggaa
ggcaagggcctcttcacctgccggatgaacatcctgggtcacatgcagcagggcggctca
cccactcccttcgatcgcaatatgggtaccaaaatggccgccaagtgtgtcgactggctg
gccacccagatcaaggcgaacatagacgccaacggagtggtcaactgcaagtccccggac
accgccactctgctgggaatcgtgtcgcgacagtaccgcttctcaccactggtcgacctc
attgccgagacgaacttcgatcaacgaatcccgaagaagcagtggtggctgcgcctgcgt
cccctgctgcgtatcctggccaagcacgattccgcctacgaggaggagggtatgtacatc
accgtcgaggaggagtgtgacaccgacgcagtagcctaa

DBGET integrated database retrieval system