KEGG   Drosophila yakuba: Dyak_GE19532Help
Entry
Dyak_GE19532      CDS       T01068                                 

Definition
GE19532 gene product from transcript GE19532-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dyak_GE19532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 430 aa AA seqDB search
MSPNSMWTFGLISALLLTLGSAGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTE
PIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDEL
VDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFY
ATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLF
PKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFG
WIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIA
YGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEE
DPDEDHEKKE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaattctatgtggaccttcggcctcataagtgctctgcttttgaccttgggt
tcggcggggctatcctcgaaggttttggaactcagtgaccgctttatcgatgtccgacac
gagggccaatggttggtcatgttctatgccccgtggtgcggctactgcaagaaaacggag
cccattttcgctctggtggctcaggcgctgcatgccaccaacgttcgagtgggtcgcctt
gattgtaccaagtatccggcggcagcaaaggagttcaaggttcgtggttatccgaccatc
atgttcatcaaaggcaacatggagttcacctacaacggagaccgtggtcgtgatgagttg
gtggattatgccttgaggatgtcaggtcctccagttcagctggtcacgcgaactgagagt
gtggacatgcttaagggatcccatacgatatttttcatattcgtgggccaacaggagggc
gtggtgtgggatacatactatgctgcggctgaaggttaccaggagcatggatttttctat
gccaccagcgaagatattgctgcccagcactttgactttgagaaactgccagccgtgata
gtctacaaagaagagcagcaccacttttatccgcacgggcatttggcccacgaaatggac
cccaatgaagtaaacgaaaccgttttccagtgggtgaacgtggagaggttcacactcttt
ccaaaggtcactcggtttaacatccaccagttgctgaagaccaacaagtacttggttttg
gctgtggtacaggaggataagctcaatcaaatagctacgcatgagctggagtttcgggac
atggtggagggtgtgataagaaaacacagggcgcgatatcatgacaaattccagtttgga
tggattggcgagccatcaattgctcattctattatcttggatcagctgccaactcctcac
ttgatagcgattaattcgagcacccaacaccacttcatacccgaagatgatcccatgcaa
atgactccacaggctctgcatcttttcctagaatctatccgcaacgaaagtgcgattgcc
tatggaggagatacgtactttgtacgtttgaatcgggcgttgtttgaagtgcgaagagct
ctaagggatatgtggctgggaaatcccgtgttgaccactgttatcttcggcctgccactg
ggattcttgtcgctcatcatgtactccatattctgcggcgattgtttggtcacagaagaa
gatcccgatgaagatcacgagaagaaggagtaa

DBGET integrated database retrieval system