KEGG   Drosophila yakuba: Dyak_GE19670Help
Entry
Dyak_GE19670      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 376 aa AA seqDB search
MRILCVIVILLRLGALRDIAADQEGRSTGSWWDAVPRLLTDIATIKANILTAAPLELASN
VMDAVCSSTLFMDRIPPQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV
VLATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTFYSWSALNTDLIGEHIGV
GLTHLIELTPLRNIHLIGHSLGAHIMGTAGRTFKKLTGKLIPRITGLDPAKPCFRRENVL
PGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPIQPGCLTIGCSHTRAVEYFAE
SAYPHQEKNFMGNKCASWDKLRKRDCSAGIVSPMGYKMNPQARGMYYVDVNGWPPYGRNS
RDTIDHRLKTCYLCQK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcggattctgtgtgttattgttatcctcctgcgactcggagcattgcgagatatagct
gcagatcaagagggcaggtcgacgggaagttggtgggacgcagtgccccgacttttgact
gacatcgctaccattaaggcgaacatactcacagctgctccacttgaattggcctccaac
gtaatggatgctgtgtgttcttccaccctttttatggacagaatccctccgcaaatcact
ccggacattaggaagatgcattttcagtacatgacgccctgccagaactacagtgttcct
ctgctggaggcctcgaagttgtggaagcattctaggttcagcaaaggacgtaaggtggta
gttctggccaccggatggaccaacaccgtaaacgaatcctcggccatttcaatgatctcc
aaggcattcatgtgtcgtggcgatgtgaattttgtgattgtagatgcagctgactatgtg
gacaccttctactcttggtcggcgctaaacacggatttaattggcgagcatattggagtt
ggtctgacccaccttatagagctgaccccacttcgaaatatccacttgattggacattca
cttggagctcacattatgggcacagctggtcggacttttaagaaacttacgggaaaactt
atccccaggataactggcttggatccggccaagccgtgtttcaggcgggaaaatgtcctg
ccaggactgacgcgtggagatgccaagctggtggacataatccacactaacattggtatt
ttggccaagcgtggaccccttggggatgtggacttctatcccggcggagcacatcccatc
cagccgggctgcctaaccatcgggtgctcccataccagagcggttgagtatttcgccgag
agcgcatatccacaccaggagaaaaacttcatgggcaacaagtgcgcttcttgggataag
ctcagaaaacgggattgttctgctggcatagtttctccgatgggctataaaatgaatccg
caagccaggggcatgtactacgtagatgttaatggttggcccccttacggccgaaactca
agggatactattgatcatagattaaaaacgtgctatctgtgccaaaagtaa

DBGET integrated database retrieval system