KEGG   Drosophila yakuba: Dyak_GE19730Help
Entry
Dyak_GE19730      CDS       T01068                                 

Definition
GE19730 gene product from transcript GE19730-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dya  Drosophila yakuba
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dyak_GE19730
Enzymes [BR:dya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dyak_GE19730
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C44
   Dyak_GE19730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 563 aa AA seqDB search
MCGIFSIFSRNGEPIPTQILHGSKHSLRELAYRQSGKQRHRGPDSTGVHVIPSEGVAMVH
ERLRIVGVEMGDQPFVSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPKSDCHVILELY
EDYGKDLLQYITGMFAFALYDRTTKEVLIARDPFGIIPMYVGEDAAGNLWVASEMKCLVD
CCSKVETFTPGEARFGKVGDLKTCWQFQQSWIKEVPTQACDLALLRANLESAVRSHLQCD
VHLGALLSGGVDSSLIASIATKIMRERDPNFRLKTFSVGLKDAPDFQAARSVAKYIDSDH
KEIIFGIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPGYEDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPEDKIPGPLNKFGGEQQTRLEKYILRAAFADNYLPDEVLWRQKEQFSDGVGYDWIDSI
RRVATSHVSDEEFAGAAIRFPFNTPTTKEAFYYRCIFAEQFPGESAARTVVRWVPRLDWG
CPEDPSGRAQAVHQFKSSLKNSI
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatattttccatattttcgaggaatggggaaccgatacccacgcaaatcctc
catggcagcaaacacagtctgagggaactggcctatcgacagagtggaaagcagcggcat
cgaggtccggattccacgggggtccatgtgattccctcggaaggagtggccatggttcat
gaacgcctgcgaattgtgggcgtggaaatgggcgatcagccattcgtctctgaggatggc
aacctcatcctggtggccaacggagaaatctacaactatttggagctttccgctgagatt
gctaagaaacgtggctcctacaaccccaagagcgattgccacgtaatactggaactgtac
gaggattacggaaaggatcttttgcagtacatcaccggcatgtttgcttttgccttgtac
gataggacgaccaaggaagtccttattgcccgagatccctttggcattatacccatgtat
gtgggtgaggatgcggcgggaaacctttgggtggcctcggagatgaagtgcctggtggac
tgctgctccaaggtggagactttcacacctggcgaggctcgcttcggaaaagttggtgac
cttaaaacatgctggcagtttcaacagtcttggatcaaggaggtgcccactcaagcctgc
gatttagctctactgcgagccaacttggagtctgcggtgcgaagtcatctgcagtgcgat
gttcacctgggagctctgctgtccggcggagtggattccagtcttatagcctccatagcc
acaaagataatgcgcgaaagagatcccaactttcgactgaaaaccttttctgtgggtcta
aaggatgcacccgacttccaggcggccaggagtgtggccaaatatatagacagtgatcat
aaggaaatcatattcgggatcgacgaagctctggatggcatcagggatattgtctatcac
ttggaaacgtatgatgtgaccaccgtgagatgtagtttgcccatgctgttactggctaga
tatatcaagagcaccggcatcaagatgatcctctccggcgaaggagccgatgagatcttt
ggaggctatttatactttcacaaggccccaggctacgaggatttccacgaggagttggtg
aagagagtgcgccagctgcatttatccgattgtctgcgggccaacaaggtagccatggcc
aagggagtggagctgcgagtgccctttctggacacggggttcgttaaccatgtgatgcaa
atccgaccggaggataagatccccgggccccttaacaaattcgggggagaacagcaaacg
cgattggaaaagtatatcttgcgagccgcctttgcggataactacctgcccgatgaagtc
ctctggcgccaaaaggaacagttctccgacggtgtgggatacgattggatcgacagcatc
cgcagggtggccaccagccatgtcagcgatgaagaattcgccggagccgccatacggttt
ccctttaacacgcccaccaccaaggaggccttctactatcgttgcattttcgctgaacaa
ttccccggagaatcggcagcccgaaccgtagtcagatgggtgccacgcctcgattgggga
tgtccggaggatccatccggacgggcacaggccgttcaccagttcaagtctagtctgaag
aattccatttaa

DBGET integrated database retrieval system