KEGG   Drosophila yakuba: Dyak_GE19781Help
Entry
Dyak_GE19781      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
dya  Drosophila yakuba
Pathway
dya00010  Glycolysis / Gluconeogenesis
dya00052  Galactose metabolism
dya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE19781
   00052 Galactose metabolism
    Dyak_GE19781
Enzymes [BR:dya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dyak_GE19781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 6534602
NCBI-ProteinID: XP_002095277
FlyBase: FBpp0264791 FBgn0237114
UniProt: B4ITE9
Position
3L
AA seq 367 aa AA seqDB search
MVRVIEDMFGIAVNPMTQKTDRVRRFTLSTERGMSVSILTMGAIIQSLKVPDFNGKLEDV
CLGYDDVAGYYRNQQCFFGATIGRVANRTAHGRFKLCGKEVSVSRNIRDRHHQHGGFVGF
DSVIWDVVGVHKDGVTLQHISPDGHEGYPGELTTNINFSLNETGCFGMRIEARTKATTVV
NISNHSYFNLGGHGAGRDPLYQHMLMIKAQKIVDVDQELLPTGKLMRVRTTPYDFSSLVS
LGKRLNQVSACPLGGFDNHFCVDIPPNRVQLVARVVHPCSGRFMEVHTNQPGLQFSTANH
LPDEDSADIPNVGKDGVRYVRQGAFTLQTQKYPDAMNHCDFPTIVLNPGQLYDHQVVYRF
GACPKRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgagtgatcgaggacatgttcggcatcgccgtcaacccgatgacgcagaagacc
gaccgggttcggcgcttcacgctgagcacagagcgtgggatgtcggtgtcgatcctaacg
atgggtgccatcatccagtccttgaaggttcccgacttcaacggcaagctggaggacgtg
tgcctgggctacgacgacgtggcagggtactaccgtaaccagcagtgcttctttggagcc
accattggccgcgttgccaaccgcacagcacatggtcgcttcaagctctgcggcaaggag
gtcagtgtgagtcgcaatattcgggatagacatcaccagcacggcggattcgtgggcttc
gacagcgtcatctgggacgtggtgggggtgcacaaagacggcgtcaccttgcagcacatc
tcgccggatgggcacgagggctatccgggcgagctgaccaccaacattaacttctcgctc
aacgagacgggctgctttgggatgcgaatagaggcgcggacgaaggctaccacggtggtg
aacatctcgaaccacagctacttcaacttgggcggccacggcgccggccgggatccgctc
tatcagcacatgctgatgatcaaggcccagaagatagtggacgtggaccaggagcttctg
cccaccggaaagttaatgcgcgtccgcaccacgccgtacgacttctccagcctggtcagt
ctgggcaagcggctcaatcaggtgtccgcttgccccctgggcggcttcgacaaccatttc
tgcgtggatattcctcccaaccgggtgcaactggtggcccgtgtggttcatccatgtagc
ggccgtttcatggaggtccacaccaaccagccgggcctgcagttcagcacggccaaccat
ctgccggacgaggacagcgcggacatacccaacgtgggcaaggatggggtccgctatgtc
cgccagggagccttcaccctgcagacgcagaagtaccccgacgcaatgaaccactgcgac
ttccccacaatcgtgctcaatcctggccagctgtacgatcaccaggtggtttaccgattt
ggcgcctgtcccaagcgagtgtag

DBGET integrated database retrieval system