KEGG   Drosophila yakuba: Dyak_GE19781Help
Entry
Dyak_GE19781      CDS       T01068                                 

Definition
GE19781 gene product from transcript GE19781-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE19781
   00052 Galactose metabolism
    Dyak_GE19781
Enzymes [BR:dya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dyak_GE19781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 367 aa AA seqDB search
MVRVIEDMFGIAVNPMTQKTDRVRRFTLSTERGMSVSILTMGAIIQSLKVPDFNGKLEDV
CLGYDDVAGYYRNQQCFFGATIGRVANRTAHGRFKLCGKEVSVSRNIRDRHHQHGGFVGF
DSVIWDVVGVHKDGVTLQHISPDGHEGYPGELTTNINFSLNETGCFGMRIEARTKATTVV
NISNHSYFNLGGHGAGRDPLYQHMLMIKAQKIVDVDQELLPTGKLMRVRTTPYDFSSLVS
LGKRLNQVSACPLGGFDNHFCVDIPPNRVQLVARVVHPCSGRFMEVHTNQPGLQFSTANH
LPDEDSADIPNVGKDGVRYVRQGAFTLQTQKYPDAMNHCDFPTIVLNPGQLYDHQVVYRF
GACPKRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgagtgatcgaggacatgttcggcatcgccgtcaacccgatgacgcagaagacc
gaccgggttcggcgcttcacgctgagcacagagcgtgggatgtcggtgtcgatcctaacg
atgggtgccatcatccagtccttgaaggttcccgacttcaacggcaagctggaggacgtg
tgcctgggctacgacgacgtggcagggtactaccgtaaccagcagtgcttctttggagcc
accattggccgcgttgccaaccgcacagcacatggtcgcttcaagctctgcggcaaggag
gtcagtgtgagtcgcaatattcgggatagacatcaccagcacggcggattcgtgggcttc
gacagcgtcatctgggacgtggtgggggtgcacaaagacggcgtcaccttgcagcacatc
tcgccggatgggcacgagggctatccgggcgagctgaccaccaacattaacttctcgctc
aacgagacgggctgctttgggatgcgaatagaggcgcggacgaaggctaccacggtggtg
aacatctcgaaccacagctacttcaacttgggcggccacggcgccggccgggatccgctc
tatcagcacatgctgatgatcaaggcccagaagatagtggacgtggaccaggagcttctg
cccaccggaaagttaatgcgcgtccgcaccacgccgtacgacttctccagcctggtcagt
ctgggcaagcggctcaatcaggtgtccgcttgccccctgggcggcttcgacaaccatttc
tgcgtggatattcctcccaaccgggtgcaactggtggcccgtgtggttcatccatgtagc
ggccgtttcatggaggtccacaccaaccagccgggcctgcagttcagcacggccaaccat
ctgccggacgaggacagcgcggacatacccaacgtgggcaaggatggggtccgctatgtc
cgccagggagccttcaccctgcagacgcagaagtaccccgacgcaatgaaccactgcgac
ttccccacaatcgtgctcaatcctggccagctgtacgatcaccaggtggtttaccgattt
ggcgcctgtcccaagcgagtgtag

DBGET integrated database retrieval system