KEGG   Drosophila yakuba: Dyak_GE19794Help
Entry
Dyak_GE19794      CDS       T01068                                 

Definition
GE19794 gene product from transcript GE19794-RA
Orthology
K06634  
cyclin H
Organism
dya  Drosophila yakuba
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dya03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dya03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMDFRVEQNSKYIEAHEDEAQGRDPNEHFLTPAEERLLLKQY
EIYLFDFCRRFDPPMPKCVVGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQHP
ERLRPHIDSFIDSTFYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDRDKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPADDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccgtgagctctcaaaagaggtcctggaccttcgccaacgagggtcagcttatg
gacttccgtgtggagcagaacagcaagtacatcgaggcgcacgaggacgaggcgcagggt
cgcgaccctaatgagcactttctcacgccggcggaggagcgtctgttgctgaagcagtac
gagatctacctcttcgacttctgccgccgcttcgatccgccgatgcccaagtgcgttgtg
ggaacagccttccactactttaagcggttctatctgaacaacacccccatggactatcac
cccaaagagatcctagccacatgcgtgttcgttgcctgcaaagtggaagaattcaacgtg
tctatcaaccagttcgttaacaacatcaagggcgacaggaacaaggccacagacatagtg
ttatccaatgaattactgctgattggacagctcaactactacctcaccatacataatccg
ttcagacccatcgaggggtttctaatagatataaaaactcggagcaatatgcaacatcca
gagcgtctgcggccacatattgatagttttattgattccacgttctactcggatgcctgt
cttttgcatacgccctcgcaaattgcattagctgccgttctccacgctgccagcagagaa
caggagaatcttgatagctatgtgacggatcttctttttgtttccgccagggagaagcta
cccggactcatagatgccgtaagaaaaattcgtataatggtgaagcaatatcagcagccc
gatcgggataaggttaaggccatcgagaagaaattagataagtgccgcaatcaagccaat
aatcctgatagcgaactctataaggagcgcttacgccgattgtacaccgatgaggatgac
atgcccgcggacgatgcctcattccacattgcagacgtgagttcggatacatcagctatg
aacataagccaatag

DBGET integrated database retrieval system