KEGG   Drosophila yakuba: Dyak_GE19977Help
Entry
Dyak_GE19977      CDS       T01068                                 

Definition
GE19977 gene product from transcript GE19977-RA
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dya  Drosophila yakuba
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dya04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 496 aa AA seqDB search
MKFLICALFLAASYVAASAEAEIKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCK
ALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGAPVEYSGGR
QAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKAANALD
SFVFGVSSNADVIAKYEAESNGVILFKPFDDKKSVFEGELTEENLKKFAQVQSLPLIVEF
NHESASKIFGGSIKSHLLFFVSREAGHIEKYVDPLKEIAKQYRDDILFVTISSDEEDHTR
IFEFFGMNKEEVPTIRLIKLEEDMAKYKPESNDLSAETIEAFLKKFLDGKLKQHLLSQEL
PEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKDNEDI
VIAKMDSTANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVADAEP
VEETEEEEEAPKKDEL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctgatctgtgcacttttcctggcggcgtcctacgtggccgcttccgccgag
gcggagatcaaagttgaggagggcgttctggtggcgaccgtggacaacttcaagcagctg
attgccgacaacgagttcgtgctggtcgagttctacgccccatggtgcggacactgcaag
gctctggctcccgagtacgccaaggctgcccagcagctggccgagaaggagtcgcccatc
aagcttgccaaggtcgatgccaccgtcgagggtgagctggccgagcagtacgccgtccgt
ggctaccccactctgaagttcttccgcagcggcgctcccgtggagtacagcggtggccgt
caggctgctgacatcattgcctgggtgaccaagaagaccggcccaccagccaaggatctg
accagcgtcgctgatgccgagcagttccttaaggacaacgagatcgccatcattggattc
ttcaaggatctggaatcggaggaggccaagaccttcaccaaggccgccaacgctctggac
tcgttcgtcttcggtgtgagcagcaatgctgatgtgattgccaagtacgaggctgagagc
aatggagtgattctgttcaagcccttcgacgacaagaagtccgtgttcgagggtgagctg
accgaggagaacctgaagaagttcgcccaggtgcaatctctgcccctgatcgttgaattc
aaccacgagtctgcttccaagatcttcggtggctccatcaagtcgcatctgctgttcttc
gtgtcccgggaagccggccacattgagaagtacgtcgatcccctgaaggagatcgccaag
cagtaccgcgacgacatcctgttcgtgaccatctcatccgacgaggaggaccacacccgc
atcttcgagttcttcggcatgaacaaggaggaggtgcccaccatccgtctgatcaagctg
gaagaggacatggccaagtacaagcccgaatcgaacgatctgtccgccgagaccatcgag
gccttcctcaagaagttcctggacggcaagctgaagcagcacctgctctcccaggaactg
cccgaggactgggacaagaaccccgttaaggtgctggtctccagcaactttgagagcgtt
gccctggacaagagcaagagcgtgctggttgagttctacgccccatggtgcggacactgc
aagcagctggcccccatctacgaccagctggccgagaagtacaaggacaatgaggacatt
gtcattgccaagatggactccaccgccaacgagctggagagcatcaagatctcgtccttc
cccacaatcaagtacttccgcaaggaggacaacaaggtcatcgacttcaacctggacagg
actctcgatgatttcgtcaagttcctcgatgccaacggtgaggtggccgatgccgagccc
gtcgaggagaccgaggaggaggaggaggcgcccaagaaggacgagttgtaa

DBGET integrated database retrieval system