KEGG   Drosophila yakuba: Dyak_GE20112Help
Entry
Dyak_GE20112      CDS       T01068                                 

Gene name
dyak_GLEANR_3960
Definition
(RefSeq) GE20112 gene product from transcript GE20112-RA (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dyak_GE20112 (dyak_GLEANR_3960)
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE20112 (dyak_GLEANR_3960)
Transcription machinery [BR:dya03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dyak_GE20112 (dyak_GLEANR_3960)
Chromosome [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dyak_GE20112 (dyak_GLEANR_3960)
   HAT complexes
    PCAF complex
     Dyak_GE20112 (dyak_GLEANR_3960)
    STAGA complex
     Dyak_GE20112 (dyak_GLEANR_3960)
    TFTC complex
     Dyak_GE20112 (dyak_GLEANR_3960)
    SAGA complex
     Dyak_GE20112 (dyak_GLEANR_3960)
    SLIK complex
     Dyak_GE20112 (dyak_GLEANR_3960)
    ADA-HAT complex
     Dyak_GE20112 (dyak_GLEANR_3960)
    HAT-A2 complex
     Dyak_GE20112 (dyak_GLEANR_3960)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 814 aa AA seqDB search
MSGGPSITLKSQPIDGNNTGNAAAQQQQQGANGAASAGASGGTAGTAQNPGHGGAAGGAG
SVPAEGTRQNSLQRIQQRKLKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRHRD
VESSYCPEFNEECRNASCRHSLKSHIAHLDNISSSSMDELLGAIIDMENLFMSMQRVEDE
DTKKVYLYLFRLLRQCVLTRQQAVIRGPLGDPPFEAPCITKAVLSLVFYKYHHLNTPELQ
TMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQFE
TSLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITQMPKFLETLRAELLKDDSP
IWDPNYRPPNSFVIQQRKRHQEVATVPIGPSVASIGGTKRASVGEPLQKRIKKEPTERPS
SENLDDLPTDVVMHAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSL
TKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPF
PSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFS
KDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRNQSEILKELIAQRHNEVQK
VRPGLTCFKEGLPSIPVESIPGLREIGWKPQMRPARSSRPLEESSDPEKLATSFASVLQS
VRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSN
CRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccatccataacgctgaaaagccaaccaatcgatggtaacaacacgggc
aacgctgcggcgcaacagcagcagcagggagcgaatggcgcagcatccgctggtgcatct
ggaggcaccgctggcaccgcccagaatccaggacacggaggggctgcgggcggcgcaggc
agtgtgccggcggagggaacgcgtcagaacagcctgcagcggatccagcagcgaaagctg
aaggtcttcaatctgcccgtgccacagaaattggccaaactgtcgatgtattccgcctgc
cagtcggaaggatgccgctgcaccggctggaaaacaccgcaggaaaatcgccatcgcgac
gtggagtcctcctactgtccggagttcaacgaggagtgccgcaacgctagctgtcgccat
tccctgaaatcgcacatagcccatctggacaatatatccagttccagcatggacgagtta
ctaggcgccatcatagacatggagaacctgttcatgtccatgcagcgcgtcgaggacgag
gacaccaagaaggtgtacctgtatctcttccgtttgctgcgccagtgcgtcctcacgcgc
cagcaggcggtcatccgcggtccgcttggagatccgccattcgaggcgccctgcatcacc
aaggctgtgctgtcgctggtcttctacaagtaccatcacctgaacacgcctgaactccag
accatgaccgaggtggccaagacgttcttgaactttctgaaccactacaactttgaatcg
ccgtcgaccagaaggggagatctcacccacgaggatgcctctaactacaaaattaactac
actaggtggttggtcttctgccacgtgcccgccttttgtaactccctgcgccaatttgaa
acgtccctagtctttggacgaacgctcctgcgcaccgtattccagtgcatgtcgcagcag
ctgaaaaagaagtgcatctccgagcgggatcgctttcccgaggacaagcgttcgatcatc
acgcagatgccgaaatttctggaaacccttcgcgccgaattgctcaaggatgattcgccc
atctgggatcccaactaccgcccgccaaattcctttgtcatccagcagcgaaagcgtcac
caggaggtggcaactgtacccatcggtcctagtgtagccagcattggaggcacaaagagg
gccagtgtgggtgaaccgctccaaaagagaatcaaaaaggagcccacagagcgaccaagc
agtgagaatttggatgacctgcccacggatgtggtgatgcacgccatgaaatcggtgtca
gagtcaaagaccaccaacaaggcggagatactcttcccggtaaatgtgtcgcgcgatgag
aacgtgaaggcggaggagcagaagcgagccatcgagttccatgtggtgggcaattcgctg
accaaaccggtggacaagcagacggttttgtggctactgggcctgcagctcgtatttgcc
tatcagctacccgagatgccacgcgagtacatcagccagctggtcttcgacaccaagcac
aaaaccctggcgctcatcaaggaaaaccagcccatcggcggcatctgcttccgcccgttc
ccgtcgcagggtttcaccgagatcgtattctgtgcggtcaccatgtcggaacaagttaag
ggctatggaacgcacttgatgaaccacttgaaggactacagcatacagagaggcatcaaa
catctgctcacattcgccgattgcgatgccatcgggtatttcaagaagcagggtttctcc
aaggacatcaagttggcgcgaccagtttatgccggctatatcaaggagtacgacagtgcc
actctgatgcactgcgagctacacccgagcattgtgaacacgcagttcattgctgtgatt
cgcaaccagagcgagattctgaaggagctcatcgcacaacgccacaacgaggtgcagaaa
gtaagacccggcttgacttgcttcaaggagggtctgccctccattcccgtggaatcgatt
cctggtctacgagagatcggctggaagccacaaatgcgcccggcacgctcatcgcgaccc
ctcgaggaatcctccgatccggagaagctggccacgtcctttgcatccgtgctgcagtcc
gtgcgccaacacaccaccgcctggcccttcctgcgtccggtgacggcggccgaggttccg
gactactacgatcatatcaagtatcccatggacctgaagaccatgggagaacgcctgaag
aagggatactaccaaacgcgccgcctgttcatggcagacatggcccgcatcttctccaac
tgtcggttctacaactcgcccgacactgagtattatcggtgtgccaactccctggagcgc
tatttccagaccaaaatgcgcgagctggggctgtgggacaaatga

DBGET integrated database retrieval system